Conserved Protein Domain Family
PRK14408

?
PRK14408: PRK14408 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172884
View PSSM: PRK14408
Aligned: 3 rows
Threshold Bit Score: 364.686
Threshold Setting Gi: 13357966
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13357966    1 MDQVYNIVMAYILTLIISPLYSYLIGSLNASIILSLVFKKQDVRLFASKNAGMTNMIRVHGKKLGILTLFLDIIKPITTV 80 
170762075   1 MDQVYNIVMAYILTLIISPLYSYLIGSLNASIILSLVFKKQDVRLFASKNAGMTNMIRVHGKKLGILTLFLDIIKPITTV 80 
209554408   1 MDQVYSVAMAYILTLIISPLYSYLIGSLNASIILSLLLKKQDIRHFASKNAGMTNMTRVYGKKLGILTLFLDIVKPIITI 80 
13357966   81 SLTYIIYKYALDAPFDLSNGFNQAILVYFGGIFTIIGHCYPIFFKFQGGKGVACYGGFLITVDPIVALIGIITLLVILLI 160
170762075  81 SLTYIIYKYALDAPFDLSNGFNQAILVYFGGIFTIIGHCYPIFFKFQGGKGVACYGGFLITVDPIVALIGIITLLVILLI 160
209554408  81 SLTYIIYKYALNAPFVLSNGFNQAILVYFGGIFTIIGHCYPIFFKFQGGKGVASYGGFLITIDPIVAVIGIITLLIILLI 160
13357966  161 TKYMSLSAMITATFTCFLVLVPGINYIPYYNQNFTTYFFDLNYVIKGIWYVWFFLLVSASLLIYRHKTNILSIATKQERK 240
170762075 161 TKYMSLSAMITATFTCFLVLVPGINYIPYYNQNFTTYFFDLNYVIKGIWYVWFFLLVSASLLIYRHKTNILSIATKQERK 240
209554408 161 TKYMSLSAMITATITCFLVLIPGINYIPYYNEHFVEYLFDLNHVIKGTWYVWLFLLISASILIYRHKTNILSIATKQERK 240
13357966  241 TILFHTKSKDNLSDVNK 257
170762075 241 TILFHTKSKDNLSDVNK 257
209554408 241 TFLFQPKPKNNI----- 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap