Conserved Protein Domain Family
PRK14407

?
PRK14407: PRK14407 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172883
View PSSM: PRK14407
Aligned: 4 rows
Threshold Bit Score: 341.496
Threshold Setting Gi: 167647551
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209549373   1 MVFWIAAAVGLAIAYLLGSIPTGYLAGKLLKGIDIREHGSKSTGATNVLRTLGKWPASMVLLVDILKGVGAIAFARGFCL 80 
167647551   1 MFFWLTNALGLGTAYLIGSLPTGFLAGKILKGVDIRQYGSSSTGATNVLRTLGFWPFVFVLAIDGLKGAAAIIFVRWLCQ 80 
116252180   1 MVFWIAGAVGLAIAYLLGSTPSGYLAGKLIRGIDIREHGSKSTGATNVLRTLGKWPALVVLLVDVLKGVGAVVFARWFYS 80 
241204680   1 MVFWMAGAVGLTIAYLLGSTPSGYLAGKLIRGIDIREHGSKSTGATNVLRTLGKWPAFVVLLVDVLKGVGAVVFARWFYP 80 
209549373  81 WLSTVPSATPPAALDLQKSEPWAVCLAGLAVLLGHSRSVWLNFTGGKSAATGLGVLLAMSWPVGLGAATVFGAALAISRI 160
167647551  81 ALLAWPAAKPPAWIEPSLFASWAVCLAGLAVLLGHARSIWLNFSGGKSVAAGVGMLAALSWPVALASLTVFGVSLAILRT 160
116252180  81 WFSTLSSGMPPTALDLQSLEPWAVCLTGLAVLLGHGRSVWLNFTGGKSVAAGLGVLLAMSWPVGLGAAMVFGVALAISRI 160
241204680  81 WFSTVSSGTPPTALDLQSLEPWAVCLAGLAALLGHGRSVWLNFTGGKSVATGLGVLLAMSWPVGLGAVAVFGVTLAAFRI 160
209549373 161 VSLSSMLAALTAMALVCGLEQPLPYRLLVIAGGVYVIVRHRANFQRLLAGTEPRLGKVA 219
167647551 161 MSVSSMLAAVTAIGFVCVLEEPLAYRVLVIVGAVFVIVRHRANIRRLLSGTEPRVGQTS 219
116252180 161 VSLSSMLAALTAIALVCGLEQPLPYRLLVIAGGIYVIARHRTNIRRLLAGTEPRLGKVA 219
241204680 161 VSLSSILAALTAIALVCGLEQPLPYRLLVIAGGIYVIARHRTNIRRLLAGTEPRLGKVA 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap