Conserved Protein Domain Family
PRK14406

?
PRK14406: PRK14406 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172882
View PSSM: PRK14406
Aligned: 3 rows
Threshold Bit Score: 283.629
Threshold Setting Gi: 150020705
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154249606   1 MIWVAAIVGYFIGSIPFSYIIPRLRGIDITKVGSGNVGGTNVLRNLGTGYGALAMFLDIMKAVVAVLIFKNQGENAMVMA 80 
150020705   2 EYIYSIFIGYFFGAIPFSFFIAKLKGIDIRKTGSGNVGGTNVLRNAGAFYGALAFFFDIFKAYIAVFLVKGFGIKFMLIA 81 
217077019   3 HHIYAILIGYFLGAIPFSFLIGKLKGIDIRKVGSGNVGGTNVLRSAGALYGALAFFLDILKGYLAVIFVSSFGINAMLLS 82 
154249606  81 GAMSVFGHCYSPFVKFKGGKGVATTLGSFFAIFPQAGMFALGIWIAIVALTQYVSLASIIGLLAGTIFTLVFGKNYWIIF 160
150020705  82 GTMAVLGHCYSIFLKFKGGKGVASTFGVFLAVYPWSGLVFFGVWLFIVAVTKYVSLASMIGLIFASIFVFFAGKDFWVIF 161
217077019  83 GSFAVFGHCFPIYLKFKGGKGVATTFGVFLAINPWSGLVFFLIWLLIVIFTKYVSLGSIVGLLGASIFTFFIGKDYWVIF 162
154249606 161 LALTLFSVYRHKENIKRLLEGNERKTNVVDYFLGWMDRK 199
150020705 162 LALSLFSILRHKDNIQRLINGNERKTDVIGYFFGKGKKN 200
217077019 163 LALALFSTLRHKENIKRLLNGNERKTDVVKYFFGKGKKD 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap