Conserved Protein Domain Family
PRK14403

?
PRK14403: PRK14403 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172879
View PSSM: PRK14403
Aligned: 5 rows
Threshold Bit Score: 332.298
Threshold Setting Gi: 222100020
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
222100020   1 MEWWVLPLLGYLIGSIPFSYLIPKWLKGVDVRKVGSGNVGATNAIRTTGPVVGGLCLLLDALKGFFPAFLAGYISGNPKL 80 
170289128   1 MYWWFFPVLGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGATNAIRTTGPLVGGICLLLDALKGFFPVFIAATFSGDPKI 80 
148270477   1 MGWWLFPILGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGATNAIRTTGPVVGGICLLLDALKGFFPVFIATTFSGDPKL 80 
15644196    1 MGWWLFPILGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGATNAIRTTGPAVGGICLLLDALKGFFPVFITITFSGDSKI 80 
281412784   1 MGWWLFPILGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGATNAIRTTGPVVGGICLLLDALKGFFPVFIATTFSGDPKL 80 
222100020  81 VSLTAILTVLGHDFPVFMKFKGGKGVASTLGVIFYLSWPTGVVFSLVWFFVVMITGYASLGSLIGLYTSALLGYLLKGYD 160
170289128  81 VSLTAIATVLGHDFSIFMKFKGGKGVASTLGIIFCLSWPTGLVFTLIWLVIVILTKYASLGSLVALYVSALLGYLLKGYD 160
148270477  81 VSLTAIATVLGHDFPIFMKFKGGKGVASTLGIIFCLSWPTGIVFTLTWLVIVMLTKYASLGSLVALYISALLGYLFKGYD 160
15644196   81 VSLTAIATVLGHDFPIFMKFKGGKGVASTLGIIFCLSWPTGLVFTLTWLVIVMLTKYASLGSLVALYVSALLGYLLKGYD 160
281412784  81 VSLTAIATVLGHDFPIFMKFKGGKGVASTLGIIFCLSWPTGIVFTLTWLVIVMLTKYASLGSLVALYISALLGYLFKGYD 160
222100020 161 AGMLILILAVLSTLRHSENIQRLLSGTERKVTLFKR 196
170289128 161 TGMLILILAVLSTLRHSENIQRLLNGTERKVNLFKR 196
148270477 161 TGMLILILAVLSTLRHSENIQRLLNGTERKVNLFKR 196
15644196  161 TGMLFLILAVLSTLRHSENIQRLLNGTERKVNLFKR 196
281412784 161 TGMLILILAVLSTLRHSENIQRLLNGTERKVNLFKR 196
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap