Conserved Protein Domain Family
PRK14395

?
PRK14395: PRK14395 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172871
View PSSM: PRK14395
Aligned: 3 rows
Threshold Bit Score: 164.407
Threshold Setting Gi: 89894996
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
89894996    1 MWEYAIFIIAYLLGAIPFAYWAGRYKGMDVRKHGSGNIGTTNAFRLLGAKLGVLVLLGDALKGALAAYLGYRfFGPWGGI 80 
167630056   8 ASSLGLIVLSFFLGSIPFAYLVGRLRGIDIRQHGSGNVGATNAFRVLGAGFGALTLILDAGKGALAAWLGLA-NGETMAV 86 
219669399   1 MWEYAIFIIAYLLGAIPFAYWAGRYKGMDVRKHGSGNIGTTNAFRLLGAKLGVLVLLGDALKGALAAYLGYRfFGPWGGI 80 
89894996   81 IAGLLAMAGHSWNPFFGFKpSGKGVASGFGIILVLMPKITVMAIVLFVLVVFLTRYVSVGSVLAALTVGILVFLFNEPMA 160
167630056  87 IAGLAAILGHTFSPFMRFK-GGKGVASAAGVVLLLVPDVTLICLLAFGLAVFLTKYVSVGSLTAAALLPLLMFFLDKPLP 165
219669399  81 IAGLLAMAGHSWNPFFGFKpSGKGVASGFGIILVLMPKITVMAIVLFVLVVFLTRYVSVGSVLAALTVGILVFLFNEPMA 160
89894996  161 YKVFAVIAVSGVVIRHRTNIQRVLKGTENKFNLKR 195
167630056 166 YQLFALVTALFVIYRHNSNIRRLLAGTENPITRKQ 200
219669399 161 YKVFAVIAVSGVVIRHRTNIQRVLKGTENKFNLKR 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap