Conserved Protein Domain Family
PRK14394

?
PRK14394: PRK14394 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172870
View PSSM: PRK14394
Aligned: 5 rows
Threshold Bit Score: 253.197
Threshold Setting Gi: 73666640
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
58616729   1 MDFQVVIFILCYFIGSIPFGFILSYVTGIGDIRKTGSGNIGATNVFRKNKKLALLTLLLDALKSFICVAIAQKYNIDNTI 80 
58578666   1 MDFQVVIFILCYLIGSIPFGFILSYVIGIGDIRKTGSGNIGATNVFRKNKKLALLTLLLDALKSFICVAIAQKYNIDNTI 80 
57238745   1 MDFQVVIFILCYLIGSIPFGFILSYVIGIGDIRKTGSGNIGATNVFRKNKKLALLTLLLDALKSFICVAIAQKYNIDNTI 80 
88658210   1 MNIHAVVIVLSYLIGSIPFGLILSYIGGLGDIRKVGSGNIGATNVFRKSKKLAVMTLLLDAVKGLISVLLAKIYSTDQTF 80 
73666640   1 MNIYTSILVLSYLIGSIPFGLILSYIGGLGDIRKIGSGNIGATNVFRKSKKLAVVTLILDSLKGFVSVMLAKNFSSDQTF 80 
58616729  81 LFLAALFAIIGHMFPVYLFFKGGKGVAPLLGSLIFIDYKVALCFLTFWIICFLLCKYASLSSIVSTLIALLFICTYYTIV 160
58578666  81 LFLAALFAIIGHMFPVYLFFKGGKGVAPLLGSLIFIDYRVAVCFLTFWIICFLLCKYASLSSIVSTLIALLFICTCYTIV 160
57238745  81 LFLAALFAIIGHMFPVYLFFKGGKGVAPLLGSLIFIDYRVAVCFLTFWIICFLLCKYASLSSIVSTLIALLFICTCYTIV 160
88658210  81 AFISAMFSIIGHMFPVWLLFKGGKGISTLLGSMVLIEYKFVICFLFIWITLFAIFKYSSLSSIVSTIFVALLVYMYYTMN 160
73666640  81 VFMSALFSIIGHMFPVWLSFKGGKGVATLLGSIMFIEYKFVIYFTIFWIIVFVIFRYSSLSSIISTISIMLLVYTHYSAN 160
58616729 161 QSVIFAITALLIITQHTDNIIRMLNKSENKINLKL 195
58578666 161 QSVIFTITALLIITQHTDNIIRMLNKSENKINLKL 195
57238745 161 QSVIFTITALLIITQHTDNIIRMLNKSENKINLKL 195
88658210 161 DTAVFIAMSLLIITQHADNIARMLSGKENKLNIGL 195
73666640 161 ESITFLVMSLLVIVQHIENIVRIIKGKENKI---- 191
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap