Conserved Protein Domain Family
PRK14393

?
PRK14393: PRK14393 
glycerol-3-phosphate acyltransferase
Statistics
?
PSSM-Id: 172869
View PSSM: PRK14393
Aligned: 9 rows
Threshold Bit Score: 268.499
Threshold Setting Gi: 78224213
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77918265    1 MTSFYIMLLAAYLIGAIPTGVVLTRLVGAsDIRNSGSGNIGATNVYRVAGKKLGVLTLIGDALKGAVPVLIAIKLtDLGD 80 
189426002   1 MTAGLFWIAGAYLLGSIPTGLLLGKLYGI-DVRNEGSGNIGATNLYRTVGRKVGILTLTGDCLKGLLPVLLAWKL-GHAE 78 
197116971   1 -MNETLLLVGAYLLGSVPTGLLLAKSMGV-DIREAGSGNIGATNVYRTIGRKLGILTLLGDCLKGLVPVLVARWL-GLPD 77 
222053917   1 MTSEIVLIIGAYLLGSIPTGLLLAKAVGV-DIRTTGSGNIGATNVYRTLGRRVGIMTLIGDCLKGLIPVLIARHL-QLPE 78 
148265937   1 MAKEITLLVCAYLLGSIPTGLLLAKASGV-NIRETGSGNIGATNVYRTLGRKVGIMTLIGDCLKGLIPVLIAKQL-GLPE 78 
118581054   5 QIACWAMIVAAYLLGSIPTGLLLGKLCGV-DVRREGSGNIGATNLYRTVGRWVGVMTLAGDCLKGAVPVLLASRY-CSPP 82 
78224213    1 MLIEILLLAGAYLLGSIPTGLLLAKAAGV-DIRTTGSGNIGATNVYRTLGRSVGIATLVGDCLKGLIPVLAAKYL-GMTD 78 
39995614    1 MLNELILTAVAYIVGSIPTGLLLARASGV-DIRATGSGNIGATNVYRTLGRTVGIATLLGDCLKGLVPVLVARKL-GFAD 78 
253699230   1 -MNETLLLVGAYLLGSVPTGLLLAKSMGV-DIRDAGSGNIGATNVYRTIGRKLGILTLLGDCLKGLVPVLVAKWL-GLPD 77 
77918265   81 AQVGAVAAAAFIGHCYPVYLKFKGGKGVATALGIFLVLSPLAVLGAFAVFALLVWKWRYVSLGSICAAAAIPILVYFTEG 160
189426002  79 PMQAWVGLAAFCGHVFSVFLLFKGGKGVATALGVFLALAPLAVLGALAVFILLVAVWRYISLGSIMAAAVMPLIIFFRPH 158
197116971  78 LWIAAAGLCAFLGHVYTIFLGFKGGKGVATALGVFLGTSPLSVLFGIVIFGSVLYKWRYVSLASITAAALIPVLVWATGG 157
222053917  79 IWVAATGLAAFLGHVYTVFLRFKGGKGVATALGVFIGISPLSVLAALAIFVFTLIKWRYVSLASITAAAAIPFLVALIEK 158
148265937  79 VWIAATGLAAFLGHVYTVFLGFKGGKGVATALGVFLGVSPLSVLIALGVFILVLVRWRYVSLASITAAAAMPLVIAFLEP 158
118581054  83 ECAAWVGLAAFSGHVFSLFLKFRGGKGVATALGVFLVLSPLAVVCALALFVGLMLVWRYVSLGSIMAAALMPLAVVFLGG 162
78224213   79 LWIALAGLAAFLGHVYTVFLGFKGGKGVATALGVFLGLAPLAVLIALGIFVAVVATSRYISLGSITAAAAMPPVVAFLSG 158
39995614   79 PWVAAVGLAAFLGHVYTIFLGFKGGKGVATALGVFLGVSPLSVLGALALFIGIVATTRYISLGSIIAAAAMPLFVAAVER 158
253699230  78 LWIAAAGLCAFLGHVYTVFLGFKGGKGVATALGVFLGTSPLSVLFGIAIFGSVLYKWRYVSLASITAAALIPVLVWGTGG 157
77918265  161 NPALVATTMFISLIVICRHHQNIQRLLNGSENRFKA 196
189426002 159 SPQLLIATVLIAAVVIIKHHSNISRLIAGTESKFKA 194
197116971 158 SVKLVLMAVVIACIVIFKHRENIARLTAGTENKFKA 193
222053917 159 KGLLITMSVIIAALVVFKHRENIRRLRSGTENVFKR 194
148265937 159 KKLLIAMSLAIAALVIYKHRENIQRLRSGTESKFKS 194
118581054 163 GRDLFWVTLIISLVVIVKHHENIRRLVAGTENRFKA 198
78224213  159 RPPLVGVTVVIALLVIWKHRENIQRLRAGTENRFKA 194
39995614  159 RPLLVGMTLVIAVIVIVKHRENIRRLREGTENRFKA 194
253699230 158 SVKLVVMAVVIACIVIFKHRENIARLTAGTESKFKA 193
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap