Conserved Protein Domain Family
PRK14391

?
PRK14391: PRK14391 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172867
View PSSM: PRK14391
Aligned: 4 rows
Threshold Bit Score: 150.565
Threshold Setting Gi: 45656062
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
116329467  1 MNQLVIQLIQLYKKIISPLLPPACRFTPTCSEYTIQAFRECGFFQAIQLSAWRILRCNPLSQGFEDPLPPNTKRTNLTHG 80 
116329929  1 MNQLVIQLIQLYKKIISPLLPPACRFTPTCSEYTIQAFRECGFFQAIQLSAWRILRCNPLSQGFEDPLPPNTKRTNLTHG 80 
45656062   1 MNRFVIQLIQLYKRLLSPLLPPACRFTPTCSEYAAQAFQEYGFFRALQLSIWRILRCNPLSRGFDDPLPPNTKG------ 74 
24212877   1 MNRFVIQLIQLYKRLLSPLLPPACRFTPTCSEYAAQAFQEYGFFRALQLSIWRILRCNPLSRGFDDPLPPNTKG------ 74 
116329467 81 RQTK 84 
116329929 81 RQTK 84 
45656062     ----    
24212877     ----    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap