Conserved Protein Domain Family
PRK14390

?
PRK14390: PRK14390 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 172866
View PSSM: PRK14390
Aligned: 4 rows
Threshold Bit Score: 116.644
Threshold Setting Gi: 123967998
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78778791   1 MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLRRLSRCHPLTPCGCDPVPD 63 
123965707  1 MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWRGGWLTLRRLSKCHPLTPCGCDPVPD 63 
123967998  1 MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLKRLSRCHPLTPCGCDPVPD 63 
157412823  1 MISFYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLKRLSRCHPLTPCGCDPVPD 63 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap