Conserved Protein Domain Family
PRK14388

?
PRK14388: PRK14388 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172864
View PSSM: PRK14388
Aligned: 9 rows
Threshold Bit Score: 151.967
Threshold Setting Gi: 51473546
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15604715   9 MAKILLLIITFYKYFISPLLGNNCLFHPTCSEYAKEAITTHGSIKGLWFTFRRIIKCQPFCSGGYDNVPTSIKNSKTPTK 88 
51473546   1 MTKILLLTITFYKYFISPLLGNNCIFSPTCSEYAQEAIITHGIIKGLWLTFRRIIKCQPFCIGGYDNVPTSIKNSKQPTK 80 
67458954   1 MTRILLLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAITTHGTLKGLWLTFKRIIKCQPFCNGGYDAVPLSIKNSKLFNK 80 
157825611  1 MSKILLLIVKFYQYFISPLLGNNCRFHPSCSEYAKEAITIYGSTKGLWITFKRIIKCQPFCNGGYDNVPISIKNYKSLNK 80 
157828354  1 MTRILLL-LRFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPFCDGGYDTVPISIKNSKPLNK 79 
165933062  1 MTRILLLLLRFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPFCDGGYDTVPISIKNSKPLNK 80 
157964432  1 MTRILLLLLRFYQYFISPLLSNNCRFHPTCSEYAKEAISMHGSIKGLWLTFKRIIKCQPFCDGGYDTVPISIKNSKPLNK 80 
229586619  1 MTRILLLLLGFYQYFISPLLGNNCRFHPTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPFCNGGYDTVPISIKNSKPLNK 80 
238651039  1 MTRILLLLLRFYQYFISPLLGNNCRFHLTCSEYAKEAISMHGSIKGLWFTFKRIIKCQPFCDGGYDTVPISIKNSKPLNK 80 
15604715  89 KI 90 
51473546  81 KI 82 
67458954  81 KI 82 
157825611 81 KI 82 
157828354 80 KI 81 
165933062 81 KI 82 
157964432 81 KI 82 
229586619 81 KI 82 
238651039 81 KI 82 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap