Conserved Protein Domain Family
PRK14386

?
PRK14386: PRK14386 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172862
View PSSM: PRK14386
Aligned: 8 rows
Threshold Bit Score: 219.518
Threshold Setting Gi: 299772122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
50086620    1 MVRILHWLIRFYQIAISPMLGPRCRYIPTCSQYSLEAIHTHGAMKGTWLAIHRVCRCHPWGGSGYDPVPPKAIRFISFQQ 80 
126643003   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
184156328   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
169634940   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPLKAIRFISFHQ 80 
169797811   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
215485158   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
213155393   1 MVRILRWFIRLYQIAISPLLGPRCRYIPTCSQYALEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
299772122   1 MVRFLRWLIRLYQIAISPLLGPRCRYIPTCSQYAIEALQTHGAIKGVWLSSKRICRCHPWGGSGYDPVPPKAIRFISFHQ 80 
50086620   81 IDSQMLHVTVPFRERLLNLNHSNHLG 106
126643003  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
184156328  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
169634940  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
169797811  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
215485158  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
213155393  81 IDSQTHHVAVPFRDRLMKQNLSNHLG 106
299772122  81 IDSQTHHVAVPFRDRLLKQNLSNHLG 106
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap