Conserved Protein Domain Family
PRK14385

?
PRK14385: PRK14385 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172861
View PSSM: PRK14385
Aligned: 6 rows
Threshold Bit Score: 111.065
Threshold Setting Gi: 119952945
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
203284068   5 RILKKIFIVINLILILLIKIYQKTLSKIVGFYCIYQPSCSNYALNCLKKYNILTAFILITLRIIRCNALFKGGCESLPTK 84 
203287607   5 RILKKIFIMINLILILLIKIYQKTLSKIVGFYCIYQPSCSNYALNCLKKYNILTAFILITLRIIRCNTLFKGGCESLPTK 84 
187918021   1 --------MFNLIFILLTKIYQKTFSKIIGFSCIYEPSCSNYALKCLRKYNIITALILIALRLLRCNALFKGGSESLPTK 72 
111114966   1 MNIFKIFFILNYTIIFLIKIYQNTFSKLFGQQCIYKPTCSKYSIECLKKYNFLTALVLMTLRTIRCNALFKGGNDFIPKY 80 
119952945   2 HIFKKLFIIFNLILILLIKIYQNTLSKIVGFHCIYEPSCSNYALECLKKYNIITALILITLRLLRCNALFKGGSESLPTE 81 
15594488    1 MNIFKILFILNYALIFLIKIYQNTLSKIFGLQCIYKPTCSKYSIECLKKYNFLTALILMTLRIIRCNALFKGGNDFTPKY 80 
203284068  85 NPILNSLKEFKTRLIK 100
203287607  85 NPILNSLKEFKTRLIK 100
187918021  73 KPILNSLKEFRQRLIK 88 
111114966  81 NPISTSLKEFQKRLIK 96 
119952945  82 KPILNSLKIFKTRLIK 97 
15594488   81 KPILESLKEFKKRLIK 96 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap