Conserved Protein Domain Family
PRK14384

?
PRK14384: PRK14384 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 172860
View PSSM: PRK14384
Aligned: 5 rows
Threshold Bit Score: 117.466
Threshold Setting Gi: 209363712
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
209363712  1 MSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEKSNEMV 56 
161829801 33 MSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEKSNEMV 88 
212217712  1 MSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEKSNEMV 56 
212211696  1 MSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEKSNEMV 56 
215919290  1 MSSCRFYPSCSCYAETALKRFGVIKGSGLTVWRLLRCHPFHPGGVDFVPEKSNEMV 56 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap