Conserved Protein Domain Family
PRK14382

?
PRK14382: PRK14382 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 172858
View PSSM: PRK14382
Aligned: 5 rows
Threshold Bit Score: 121.03
Threshold Setting Gi: 15605745
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15605745   1 MKSIVLIFLKFWQKFISPLYPSSCRYYPTCSTYAIMAVEKYGVLKGLIKAFFRVLRCNPFFKGGVDYP 68 
195953255  1 MKYLLIKFVRFWQICISPLYPSSCRFYPTCSHYAILSIEKYGAFKGGMKAFWRILRCNPWNKGGIDYP 68 
188996899  2 IKRLFINVIRFYQKYISPIKGQSCRFHPTCSEYAVLSIEKYGIIKGSLKAIWRILRCNPFSKGGVDYP 69 
225848363  2 LSKLLINLIKLYQKYVSPLKKPSCRFYPTCSNYAILAIEKYGFLKGSLKAVWRVLRCNPFSKGGVDYP 69 
225849759  1 MDRFLIKLIKIYKKFVSPALPNSCRYYPTCSSYAIQSIEKYGALKGSLKAVWRILRCNPFSKGGVDYP 68 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap