Conserved Protein Domain Family
PRK14381

?
PRK14381: PRK14381 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172857
View PSSM: PRK14381
Aligned: 7 rows
Threshold Bit Score: 193.536
Threshold Setting Gi: 33241947
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62184792   1 MSFKQLLYNLPTHLCCGLIHLYRWTISPLLGSPCRFFPSCSQYALQALKHHKCIRGLWLTIKRIGKCGPWHPGGIDLVPM 80 
29839917   1 MSFKLFIKNLPTNLCCGLIHIYRWTISPLLGSPCRFFPTCSQYALQALKHHGCIKGLGLTIKRIGKCGPWHPGGVDLVPM 80 
33241947   1 MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPK 80 
15836124   1 MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPK 80 
16752447   4 MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPK 83 
15618502   1 MSFKRFLQQIPVRICLLIIYLYQWLISPLLGSCCRFFPSCSHYAEQALKSHGFLMGCWLSIKRIGKCGPWHPGGIDMVPK 80 
89898665   1 MSFKSLLKNLPKFFFLGLIHIYRWTISPLLGSPCRFFPTCSQYALQALKHHGCIKGLGFTIKRIGKCGPWHPGGVDLVPM 80 
62184792  81 TTLEEALDVSQVTNDDDSGDSHA 103
29839917  81 TTLEEALDISPAVDDDESCDLHA 103
33241947  81 TALQEVLEPYQEIDGGDSSHFSE 103
15836124  81 TALQEVLEPYQEIDGGDSSHFSE 103
16752447  84 TALQEVLEPYQEIDGGDSSHFSE 106
15618502  81 TALQEVLEPYQEIDGGDSSHFSE 103
89898665  81 TTLEESLDISPATNDDDSCDSQA 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap