Conserved Protein Domain Family
PRK14377

?
PRK14377: PRK14377 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172853
View PSSM: PRK14377
Aligned: 7 rows
Threshold Bit Score: 161.475
Threshold Setting Gi: 76789209
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
76789209    1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
15605200    1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
15835372    1 MKTSWIKIFFQGMIHLYRWTISPLLGSPCRFFPSCSEYALVALKKHPLKRSLFLIANRLLKCGPWHIGGIDLVPGTSIEE 80 
166155562   1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
166154687   1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
237802901   1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
237804823   1 MQTSRISSFFRGLVHLYRWAISPFLGAPCRFFPTCSEYALVALKKHPLRKSLFLIAKRLLKCGPWCIGGIDLVPRTSVEE 80 
76789209   81 YLSSPTPLAESPDDRTVPHTQETS 104
15605200   81 YLSSPTPLAESPDDRTVPHTQETS 104
15835372   81 YL-------ESPDDKNVPPDQETV 97 
166155562  81 YLSSPTPLAESPDDRTVPHTQETS 104
166154687  81 YLSSPTPLAESPDDRTVPHTQETS 104
237802901  81 YLSSPTPLAESPDDRTVPHTQETS 104
237804823  81 YLSSPTPLAESPDDRTVPHTQETS 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap