Conserved Protein Domain Family
PRK14375

?
PRK14375: PRK14375 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172851
View PSSM: PRK14375
Aligned: 7 rows
Threshold Bit Score: 115.086
Threshold Setting Gi: 110669862
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110669862  1 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG 70 
115314116  1 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG 70 
89255611  13 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG 82 
118496689 13 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDPVPCKNKKG 82 
56707391   1 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG 70 
187932217 13 MLINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLTTRRLLRCHPLSKRDYYDLVPCKNKKG 82 
167626981 21 AIINLYRYCISPFIPARCRYYPTCSEYALEALKTHGILKGLYLSTRRLLRCHPFAKRDYYDLVPCKNKKV 90 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap