Conserved Protein Domain Family
PRK14373

?
PRK14373: PRK14373 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 172849
View PSSM: PRK14373
Aligned: 7 rows
Threshold Bit Score: 133.975
Threshold Setting Gi: 59802473
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121634186  1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPLGGHGHDPVP 73 
15677737   1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPVP 73 
59802473   1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPVP 73 
218767520 24 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPVP 96 
194100145  1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGLRLAIKRIARCHPFGGHGHDPVP 73 
161869309  1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPVP 73 
254804277  1 MNFLLSKLLLGLIRFYQYCISPLIPPRCRYTPTCSQYAVEAVKKYGAFKGGRLAIKRIARCHPFGGHGHDPVP 73 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap