Conserved Protein Domain Family
PRK14372

?
PRK14372: PRK14372 
membrane protein insertion efficiency factor YidD
Statistics
?
PSSM-Id: 172848
View PSSM: PRK14372
Aligned: 5 rows
Threshold Bit Score: 167.419
Threshold Setting Gi: 119026647
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119026647   1 MVRLIRWYQKHISAHTAPRCRYYPSCSSYAIQAIERFGCLKGGLLALLRLLRCNQWNRGGIDDVPQLYSLFYRCSWSKAH 80 
213693343   9 MIGGVRWYQQRISANTPPCCKYYPTCSNYAIEALERYGAFKGGVLAVLRLLRCRPWSRGGIDDVPQRYSIFYRFSWSKAH 88 
23465226    9 MIGGVRWYQQHISANTPPCCKYYPTCSNYAIEALERYGAFKGGVLAVLRLLRCRPWSRGGIDDVPQRYSVFYRFSWSKAH 88 
241197036   1 MIRCIRWYQRRISANTPPSCHYYPSCSNYALEAIERFGAIRGGMLAALRLLRCRPWKRCDIDDVPQRFSLFYRCSWSKAH 80 
241191631   1 MIRCIRWYQRRISANTPPSCHYYPSCSNYALEAIERFGAIRGGMLAALRLLRCRPWKRCDIDDVPQRFSLFYRCSWSKAH 80 
119026647  81 EEPRLTPLdvdePIGDKENGL 101
213693343  89 EEPRLTPL----ATTQREAQR 105
23465226   89 EEPRLTPL----ATTQREAQR 105
241197036  81 EEPRLTPL----PSHGKEQAA 97 
241191631  81 EEPRLTPL----PSHGKEQAA 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap