Conserved Protein Domain Family
PRK14371

?
PRK14371: PRK14371 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 172847
View PSSM: PRK14371
Aligned: 10 rows
Threshold Bit Score: 159.708
Threshold Setting Gi: 146309634
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148550510  1 MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIWRGGWLAVRRLGRCHPWNDGGFDPVPPAPSSRTSSIA 80 
146309634  1 MRKAALACIQVYRYAISPLMASHCRFYPSCSCYAYEAIEQHGFLRGGWLAARRLGRCHPWNPGGYDPVPPAKTSRSPSMA 80 
146284523  1 MRKLAIASIRVYQYAISPMMASHCRFYPSCSCYALEAIETHGLLRGGWLSLRRLGRCHPWNPGGYDPVPTHNTSNSSPMA 80 
104784448  1 MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLAVRRLGRCHPWNDGGFDPVPPAPSSRTSSIA 80 
71734893   1 MRKLALVPIQFYRYAMSPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPWNPGGYDPVPAVPTSRSSSMA 80 
77461961   1 MRKLALVPIRFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLTFRRLGRCHPWNPGGYDPVPPIPTSRSSSMA 80 
28872712   1 MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIDNHGLLRGGWLSIRRLGRCHPWNPGGYDPVPAVPTSRSSSMA 80 
26986752   1 MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIWRGGWLAVRRLGRCHPWNDGGYDPVPPAPSSRTSSIA 80 
66048359   1 MRKLALVPIQFYRYAISPLMASHCRFYPSCSCYAYEAIENHGLLRGGWLSIRRLGRCHPWNPGGYDPVPAVPTSRSSSMA 80 
226947218  1 MRKLALAAIQFYRYAISPLMANHCRFHPSCSCYAHEAISTHGLLRGGWLSLRRLGRCHPWNPGGYDPVPPIKTSRSSSMA 80 
148550510 81 E 81 
146309634 81 E 81 
146284523 81 E 81 
104784448 81 E 81 
71734893  81 E 81 
77461961  81 E 81 
28872712  81 E 81 
26986752  81 E 81 
66048359  81 E 81 
226947218 81 E 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap