Conserved Protein Domain Family
PRK14362

?
PRK14362: PRK14362 
Maf-like protein; Provisional
Statistics
?
PSSM-Id: 172838
View PSSM: PRK14362
Aligned: 5 rows
Threshold Bit Score: 274.817
Threshold Setting Gi: 218887673
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
46578942    1 MFTSTGPFTAAHPVILASGSPRRRAFFEQMGIPFEVILPVDAEPSPIEGEQPEVYVRRAAEAKARAVAADHKGR------ 74 
220905011   7 PRPALFSLAPDCRLVLASASPRRRQFLAEWGLSFELTSPAGAEPSPCPGELPDAYTRRAALAKAHAAAGLLAGKaqsllh 86 
218887673  13 PAAPAGPFRALLPVVLASGSPRRREFLHSLGLSFEVYGNGAAEPEPLPAEPPAHYARRAAAAKAASVAATRPGS------ 86 
78355687    1 -MNVDGPFTASCPVVLASGSPRRQEFLRAMGVPFSVDTAGASEPEPVEGEAAVAYARRAACAKTLPVARRHAAA------ 73 
120603457   1 MFTSTGPFTAAHPVILASGSPRRRAFFEQMGIPFEVILPVDAEPSPIEGEQPEVYVRRAAEAKARAVAADHKGR------ 74 
46578942   75 ---LVVAADTVVALDDMILGKPASADDALSMLRRLAGRTHVVASGCCVVLPEGGR--------------------ETFHS 131
220905011  87 gknIILAADTVVAVDGDILGKPRDRQDALNMLTRLSGRGHEVISAVCLLLPDTRQaatgatqtgntgsaalkpeeLVFSD 166
218887673  87 ---VVIAADTVVALHGEIMGKPQDRADALRMLSRLAGHTHEVVSACCVALPDGTR--------------------EIFHA 143
78355687   74 ---CVIGADTVVALDGVIMGKPAGHAHALSMLRALAGARHEVVSACCICLPGNAQe------------------pVVLHA 132
120603457  75 ---LVVAADTVVALDDMILGKPASADDALSMLRRLAGRTHVVASGCCVVLPEGGR--------------------ETFHS 131
46578942  132 ITRVTMWDCPEEALAAYVATGEPSDKAGAYGIQGIGAFLVRSIEGSWTNVVGLPVAELTALLLRRGAIhcqLPVEAVHA 210
220905011 167 TSRVFFHPWPEPVLRAYVATDEPCDKAGAYAIQGQGAFLVDRVEGSWSTVVGLPVTQLAALLLERGLI---LPVGEPET 242
218887673 144 ATRVTMWDAPAAALAAYAATGEPDDKAGAYGIQGVGAFLVESIDGSWSNVVGLPVAELVRLLLQHGVI---KPSAE--- 216
78355687  133 VTSVWMHRWDDAALKAYIATGEPADKAGAYGIQGIGAFLVSRIDGSWSNVVGLPLTELLTELQRRGVV---VPSGAQTA 208
120603457 132 ITRVTMWDCPEEALAAYVATGEPSDKAGAYGIQGIGAFLVRSIEGSWTNVVGLPVAELTALLLRRGAIhcqLPVEAVHA 210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap