Conserved Protein Domain Family
PRK14361

?
PRK14361: PRK14361 
Maf-like protein; Provisional
Statistics
?
PSSM-Id: 172837
View PSSM: PRK14361
Aligned: 3 rows
Threshold Bit Score: 321.11
Threshold Setting Gi: 226355998
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
94985368    1 MILASGSPRRRDLLANLGVPFRVVVSGEAEDRPERDPARLAGELATLKARAVAQSHPDAVVIAADTVVALGEELLGKPAD 80 
15806225    9 VILASGSPRRRELLGNLGVPFEVVVSGEAEDSQETDPARLALELGQLKARAVAAQHPDAVVIAADTVVALGGTLLAKPAD 88 
226355998   8 VVLASGSPRRRELLENLGVPFQVVVSGEDEDSTETDPARLAAELALLKGRSVARLHPESVVLAADTVVACEGVLLAKPAD 87 
94985368   81 EAENWAFVRRLAGRTHQVYTGVTVLSGGQESGGVERTDVTFRALTDGEIAHYARTGEGLDKAGGYGIQGVGMALVARIDG 160
15806225   89 EAENAAFLRQQSGKTQQVYTGVCVISPAGEQSGVERTDVTFRALTEAEVTFYARSGEGLDKAGGYGIQGVGMALIERVEG 168
226355998  88 TSENEAFLRVLSGRSHQVFTGVAALHRGTEQVEVARTDVTFRPLTAAEISFYARSGEGMDKAGGYGIQALGASLVSRVEG 167
94985368  161 DYSNVVGFPLTLVIRLLRGAGVAVWGE 187
15806225  169 DYSNIVGFPLALVLRLLRGAGVSAFGV 195
226355998 168 EYTNVVGFPLSVVITLLRRAGVPVWDE 194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap