Conserved Protein Domain Family
ligA

?
PRK14350: ligA 
NAD-dependent DNA ligase LigA; Provisional
Statistics
?
PSSM-Id: 172826
View PSSM: PRK14350
Aligned: 8 rows
Threshold Bit Score: 1141.87
Threshold Setting Gi: 203284458
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187918415   1 MIEDVEDEILRLKNIIKRWNREYYVDSSPSVGDLTYDKALLRLQDLESKYPEYKTLDSPTFRFGSDLLNDFEEVKHSFPI 80 
203287992   1 MGKDIKDEILSLRDAIKKWDREYYVDSSPTVGDVTYDKALLRLQYLENRYPEYKTLDSPTLKFGSDLLNDFKEIEHSYPI 80 
203284458   1 MGKDIKDEILSLRDAIKKWDREYYVDSSPTVGDVTYDKALLRLQYLENRYPEYKTLDSPTLKFGSDLLNDFKEVEHSYPI 80 
218249478   1 MSSKVQQEIADLKKLIRKWDKEYYVDSLPSVEDFVYDKHILRLQELESKYPEYKTLDSPTLKFGSDLLNDFKEVEHSAPI 80 
51598803    1 MSIKIQQEIEDLKKLIRKWDKEYYVDSLPSVEDFVYDNHILRLKELESRHPEYKTLDSPTLKFGSDLLNNFEEVEHSVPI 80 
15594897    1 MSSKVQQEIADLKKLIRKWDKEYYVDSLPSVEDFVYDKHILRLQELESKYPEYKTLDSPTLKFGSDLLNDFKEVEHSAPI 80 
111115379   1 MSSKIQQEIADLKKLIRKWDKEYYVDSLPSVEDFVYDKHILRLQELESKCPEYKTLDSPTLKFGSDLLNDFKEVEHSVPV 80 
119953337   9 MIKDIEDEILCLRDNIRKWNKEYYVDSSPSVSDLTYDKALLRLQDLESKYPEYKTLDSPTLKFGSDLLNNFEEVTHSFPI 88 
187918415  81 LSLDKTYDIKGLSLWIEKMVLESAISGLHTGISVEPKIDGCSIVLHYKDGILEKALTRGDGRVGNDVTENVKTIRNVPLR 160
203287992  81 LSLDKAYDVKELLLWVEKMSLEGSNLGFDMGISAEPKIDGCSIVLYYKDGILEKALTRGDGRFGNNVIENVRTIKNVPLC 160
203284458  81 LSLDKAYDVKELLLWVEKMSLEGSNLGFDMGISAEPKIDGCSIVLYYKDGILEKALTRGDGRFGNNVIENVRTIKNVPLC 160
218249478  81 LSLDKVYDLDLLKSWIDKIDFNNS-----FNISVEPKIDGCSIVLYYKDGVLEKALTRGNGKFGNDVTINVRTIRYIPLF 155
51598803   81 LSLDKVYDLDLLKSWIDKIDFNNS-----FNISVEPKIDGCSIVLYYKDGILEKALTRGNGKFGNDVTKNIRTIRHIPLF 155
15594897   81 LSLDKVYDLDLLKSWIDKIDFNNS-----FNISVEPKIDGCSIVLYYKDGVLEKALTRGNGKFGNDVTINVRTIRYIPLF 155
111115379  81 LSLDKVYNLDLLKSWIDKIDFSNS-----FNISVEPKIDGCSIVLYYKDGILEKALTRGNGKFGNDVTKNIRTIRHVPLF 155
119953337  89 LSLDKAYDIKELLLWIEKMVLEGSSLGSYTGISVEPKIDGCSIVLYYKDGILQKALTRGDGRVGNDVTENVRTIKNVPLS 168
187918415 161 IDEKIELVLRGEIYITKENFLKINRTLKNPYVNARNLASGILRRISSKEVANFPLDIFVYDILYSSLKLNTSHDAFDKLK 240
203287992 161 IGERVELVLRGEIYITKKDFLKINHTLDDSYINARNLTSGILRRINSREVVNFPLDIFVYDILYSSLKLNTNHDAFDKLK 240
203284458 161 IGERVELVLRGEIYITKKDFLKINHTLDDSYINARNLTSGILRRINSREVVNFPLDIFVYDILYSSLELNTNHDAFDKLK 240
218249478 156 LDEKVDLVLRGEVYITKENFLKINKFLEKPYTNSRNLASGILRRVDSREVANFPLNIFIYDFLNAGLEFKTNDLATARLK 235
51598803  156 LDEKVDLVLRGEVYITKENFFKINKFLEKPYTSSRNLASGILRRVDSREVANFPLNIFIYDFLNAELELKTNDLAIAKLK 235
15594897  156 LDEKVDLVLRGEVYITKENFLKINKFLEKPYTNSRNLASGILRRVDSREVANFPLNIFIYDFLNAGLEFKTNDLATARLK 235
111115379 156 LGEKVDLVLRGEVYITKENFLKINKFLEKPYTNSRNLASGILRRVDSREVANFPLNIFIYDFLNAGLDFKTNNLAIEKLK 235
119953337 169 IDEKVELVLRGEIYITKENFLKINHTLKNPYLNARNLASGILRRINSREVASFPLDIFVYDILYSSFGLSTNHDAFDKLK 248
187918415 241 QFGFKVNPFCEFFGGKNLEAGIIAHVKKIEALRDSFEYEIDGVVLKIDSFILRKILGSTSHHPKWSIAYKFESCTGMSKV 320
203287992 241 HFGFKLNPFCKFFCGKNLGENIINYVKEIEEQRERFEYEIDGVVLKVNDFRLRDVLGYTSHHPKWSIAYKFESLRAVSKV 320
203284458 241 HFGFKLNPFCKFFCGKNLGENIINYVKEIEEQRERFEYEIDGVVLKVDDFRLRDVLGYTSHHPKWSIAYKFESLRAVSKV 320
218249478 236 KLGFKVNPLIRFFDLKNSIGEVLNYIADIIKKRDSFEYEIDGVVLKVSDFALRERLGYTAHHPKWAMAYKFEALSDFSRV 315
51598803  236 KLGFKVDPLIRFFDQKSSIIEVLNYIADITKKRNSFEYEIDGVVLKVSEFVLREKLGYTSHHPKWAMAYKFEALSGFSRV 315
15594897  236 KLGFKVNPLIRFFDLKNSIGEVLNYIADITKKRDSFEYEIDGVVLKVSDFALRERLGYTAHHPKWAMAYKFEALSGFSRV 315
111115379 236 KLGFKVNPLIRFFDQKSSIKEVLNYIADITKKRNSFEYEIDGVVLKVSDFALREKLGYTLHHPKWAMAYKFEALSGFSKV 315
119953337 249 KFGFKINPFCKFFGGKN-LEEITNHVKKIEMQRNSLEYEIDGVVLKVDSFILRDILGYTSHHPKWSVAYKFESCTGVSKI 327
187918415 321 VDIVVQVGRSGKITPVAHVEKVLVAGASITNASLHNQDYIDFVGLNVGDIVVISRRGDVIPAVDLVIEKLAVGSFKIPSN 400
203287992 321 IDIVVQVGRSGKITPVANIEKVLIAGAFITSASLHNQDYIDSIGLNVKDVVAISRRGDVIPAVELVVEKLSVGNFKIPNY 400
203284458 321 IDIVVQVGRSGKITPVANIEKVLIAGAFITSASLHNQDYIDSIGLNVKDVVAISRRGDVIPAVELVVEKLSVGNFKIPNY 400
218249478 316 NSIVVQVGRSGKITPVANIDKVFVSGAFITSATLHNQDYIRSIGLNVGDVVKVSRRGDVIPAVEMVINKFSTGFFKVPDN 395
51598803  316 NSIVVQVGRSGKITPVANIDKVFVSGAFITNATLHNQDYIISIGLNVGDVVKVSRRGDVIPAVEMVINKCSKGVFKVPDN 395
15594897  316 NSIVVQVGRSGKITPVANIDKVFVSGAFITSATLHNQDYIRSIGLNVGDVVKVSRRGDVIPAVEMVINKFSTGFFKVPDN 395
111115379 316 NSIVVQVGRSGKITPVANIDKVFVSGAFITNATLHNQDYITSINLNVGDIVKVSRRGDVIPAVEMVINKFSTGFFKVPDK 395
119953337 328 VDIVVQVGRSGKITPVAHVEKVFVAGAFITNASLHNQDYIDSIGLNVGDVVAISRRGDVIPAVELVVEKLSIGSFKISSN 407
187918415 401 CPSCKMTLIKEGAHLFCVNRHCSCRIIEQVKYFCSKKCMNIVGLSEKTIEFLFEKKFISSEVELYTFNCDRLINLKGFNL 480
203287992 401 CPSCKKSLIKEGAHLFCVNIHCPLKIMGHIKYFCSKKCMNIVGLSEKTIEFLFNMNFISSEIDLYTFDFDRLIGLKGFNF 480
203284458 401 CPSCKKSLIKEGAHLFCVNIHCPLKIMGHIKYFCSKKCMNIVGLSEKTIEFLFNMNFISSEIDLYTFDFDRLIGLKGFNF 480
218249478 396 CPACKTAVVKEGAHFFCPNNNCPSVAVERIKYFCSKNCMDIEGFSDKIISFLFEKKFIFSEIDLYTFDFYKLLEFKGFKD 475
51598803  396 CPACKTVLVKEGAHFFCTNNSCPSVAVERIKYFCSKNCMDIEGFSDKTISFLFEKEFISSEIDLYTFNFYKLLKFKGFKD 475
15594897  396 CPACKTAVVKEGAHFFCPNNNCPSVAVERIKYFCSKNCMDIEGFSDKIISFLFEKKFIFSEIDLYTFDFYKLLEFKGFKD 475
111115379 396 CPSCKTVVVKEGAHFFCTNNNCPSVAVERIKYFCSKNCMDIEGFSDKTISFLFEKKFISSEIDLYTFNFYKLLKFKGFKD 475
119953337 408 CPSCKMALIKEGSHLFCVNKHCPYRIIEQIKYFCSKKCMNIVGLSGKTIEFLFEMKFISSEIELYTFNFDRLINLRGFDL 487
187918415 481 KRINNLKRSIEDSKSRPFRKLLLGMGIKDLGENTILVLINNNLNSFDTISTLCKNKEAALAKLLKIKGIGERIALNIIEA 560
203287992 481 KRVNKLKRSIEESKNRPFKKLLLAMGIKDLGINTILLLINNNLNSFDAISLLCQDNKNALVKLLDIKGIGERIAFNIIRA 560
203284458 481 KRVNKLKRSIEESKNRPFKKLLLAMGIKDLGINTILLLINNNLNSFDAISLLCQDNKNALVKLLDIKGIGERIAFNIIRA 560
218249478 476 RKINNLINSIEASKKKPFSKLLLSMGIKDLGENTIMLLFLNNLNSFSKLFKLCQDRYFAFSTLLKIKGIGEKIALNIIEA 555
51598803  476 RKVYNLINSIEASKKKPFSKLLLSIGIKELGENAIRLLFLNNLNSFSKLFRLCQDRNFAFSTLLKIKGIGEKIALNIIEA 555
15594897  476 RKINNLINSIEASKKKPFSKLLLSMGIKDLGENTIRLLFLNNLNSFSKLFKLCQDRYFAFSTLLKIKGIGEKIALNIIEA 555
111115379 476 RKINNLINSIEASKKKPFSKLLLSIGIKELGENTIRLLFLNNLNSFSKLFRLCQDRDFAFLTLLKIKGIGEKIALNIIDA 555
119953337 488 KRIDNLKRSISDSKGRPFRKLLLGMGIKELGANTILVLINNNLNSFDIISTLCKNKEAALAKLLKIKGIGEKIALNIIEA 567
187918415 561 FNDKTILDKFNFFKELGLKMEEDNTNDAVYDSFLFGKKFCITGSFKGYSRDVLIEKLTKKGAVFSRSVTKCLDFLLVGEK 640
203287992 561 FNDKIILDKFNFFKKLGFKMQEDSMNCVIDSSFLFGKKFCITGSFDEYSRHVLIDKITKKGAIFHSAVSRYLDFLLVGKS 640
203284458 561 FNDKIILDKFNFFKGLGFKMQEDSINCVVDSSFLFGKKFCITGSFDEYPRHVLIDKITKKGAIFNSSVSRYLDFLLVGKS 640
218249478 556 FNDSVMLNKFKFFENLEFKMEE-VVAIDGENKLLAGKKFCITGTFNGYSRSIVIDKLKNKGAIFNTCVTGSLDFLIVGEK 634
51598803  556 FNDSTMLNKFKFFENLGFKMEE-SILIDDENRLLAGKKFCITGTFNGYSRSIIIDKLKNKGAIFKTCVTEGLDFLIVGEK 634
15594897  556 FNDSVMLNKFKFFENLEFKMEE-VVAIDGENKLLAGKKFCITGTFNGYSRSIIIDKLKNKGAIFNTCVTGSLDFLIVGEK 634
111115379 556 FNNSIMINKFKVFENLGFKMEE-RILIDDENKLLVGKKFCITGSFNGYSRPIVIDKLENKGAIFKTCVTKGLDFLVVGEK 634
119953337 568 FNDKIILDKFNFFKELGFKLEEYNTNYVVDDSFLFGKKFCITGSFEGHSRDVLIEKITKKGAIFNRAVTKRLDFLLVGEK 647
187918415 641 FGLKVQKANNLGIKTFSLFDIKDFVDLDD 669
203287992 641 PGLKLKKANNLGIKILSLFDIKNLVNLDD 669
203284458 641 PGLKLKKANNLGIKILSLFDIKNLVNLDD 669
218249478 635 AGSKLKKALSLNIKIMSFEDIKSYLD--- 660
51598803  635 AGSKLEKALNLNVKIMSFEDIKSYLN--- 660
15594897  635 AGSKLKKALSLNIKIMSFEDIKSYLD--- 660
111115379 635 AGTKLKKALNLNVKIMSFEDIKSYLD--- 660
119953337 648 PGLKLQKANNLGIKTFGLFDIKDFVDLDN 676
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap