Conserved Protein Domain Family
PRK14349

?
PRK14349: PRK14349 
lipoyl(octanoyl) transferase LipB
Statistics
?
PSSM-Id: 172825
View PSSM: PRK14349
Aligned: 5 rows
Threshold Bit Score: 405.124
Threshold Setting Gi: 187476653
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33591364    1 MIKWLARPADYASVWDAMKTFTAARGPGTADEIWLCEHAPVYTLGQVGRPEHLLNPGLIPVVHCDRGGQVTYHGPGQVLA 80 
33594887    1 MIKWLARPADYGSVWDAMKAFTAARGPGTADEIWLCEHAPVYTLGQAGRPEHLLNPGLIPVVHCDRGGQVTYHGPGQVLA 80 
33599162    1 MIKWLARPADYGSVWDAMKAFTAARGPGTADEIWLCEHAPVYTLGQAGRPEHLLNPGLIPVVHCDRGGQVTYHGPGQVLA 80 
163859125   1 MIKWLTRPADYAPVWQDMRAFTAGRGAATPDEVWLCEHAPVYTLGQAGKPEHLLNPGAIPVVMCDRGGQVTYHGPGQVVA 80 
187476653   4 NVAWLSPGAAYADVWEAMKAFTASRGPATPDEIWLCEHAPVYTLGQAGLPQHVLNPADIAVVRSDRGGQVTYHGPGQIVV 83 
33591364   81 YTLFDLRRAGLYVREYVDMLEQATLATLRELGLEQACRKPGAPGIYVP-QPGGELAKIAALGVKVRNGYAYHGLALNIDM 159
33594887   81 YTLFDLRRAGLYVREYVDMLEQATLATLRELGLEQACRKPGAPGIYVP-QPGGELAKIAALGVKVRNGYAYHGLALNIDM 159
33599162   81 YTLFDLRRAGLYVREYVDMLEQATLATLRELGLEQACRKPGAPGIYVP-QPGGELAKIAALGVKVRNGYAYHGLALNIDM 159
163859125  81 YTLFDLRRAGLFVREYVRLLEDAAIGTLDDFGVPGACRKPGAPGVYVPlGPAGELAKIAALGIKIRNGYAYHGVALNVDM 160
187476653  84 YCLFDLRRAGMYVRDYVALLEETAIAVLGRAGIV-AQRKPGAPGVYVE-QPGQTLAKIAALGIKIRKGCAYHGLSLNVAM 161
33591364  160 DLSPFLGINPCGYEGLRTVDLAACGVRTSVERAGELLAAQLARAHGQAVQQRAAALAGVPG 220
33594887  160 DLSPFLGINPCGYEGLRTVDLAACGVRTSVERAGELLAAQLARAHGHAVQQRAAALAGVPG 220
33599162  160 DLSPFLGINPCGYEGLRTVDLAACGVRTSVERAGELLAAQLARAHGQAVQQRAAALAGVPG 220
163859125 161 DLSPFLGINPCGYEGLVTVDMAACGVRRDLVDVGQRLAERL-----------LAAMPEPAG 210
187476653 162 DLTPFHGINPCGYEGLQTTDMASCGLSCSVHEVGQALADELVR--------RLSAYQGSLS 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap