Conserved Protein Domain Family
PRK14348

?
PRK14348: PRK14348 
lipoyl(octanoyl) transferase LipB
Statistics
?
PSSM-Id: 172824
View PSSM: PRK14348
Aligned: 3 rows
Threshold Bit Score: 460.646
Threshold Setting Gi: 60681572
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29346499   1 MKTVLVDWNLIPYAEAWQRQTEWFDTLVRAKAQGEAYENRIIMCEHPHVYTLGRSGKENNMLLNDDQLKAIQATLFHIDR 80 
60681572   1 MKTITTDWELIPYSEAWSRQTEWFDALVHAKQNGESYENRIIFCEHPHVYTLGRSGKENNMLLGEEQLKTIGATLYHIDR 80 
53713323   1 MKTITTDWELIPYSEAWSRQTEWFDALVHAKQNGESYENRIIFCEHPHVYTLGRSGKENNMLLGEEQLKTIGATLYHIDR 80 
29346499  81 GGDITYHGPGQLVCYPILNLEEFHLGLKEYVHLLEEAVIRVCASYGIEAGRLEKATGVWLEGSTPRARKICAIGVRSSHY 160
60681572  81 GGDITYHGPGQLVCYPILNLEEFGLGLKEYVHLLEEAVIRVCASYGVVAGRLEKATGVWLEGDTSRARKICAIGVRSSHY 160
53713323  81 GGDITYHGPGQLVCYPILNLEEFGLGLKEYVHLLEEAVIRVCASYGVVAGRLEKATGVWLEGDTSRARKICAIGVRSSHY 160
29346499 161 VTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLRQELKHEVPMDEVKQRLECELGRLLNEK 221
60681572 161 VTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQQELGHSIDMAEVKERLGRELLAALLSK 221
53713323 161 VTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQQELGRSIDMAEVKERLGRELLAALLSK 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap