Conserved Protein Domain Family
PRK14347

?
PRK14347: PRK14347 
lipoyl(octanoyl) transferase LipB
Statistics
?
PSSM-Id: 172823
View PSSM: PRK14347
Aligned: 13 rows
Threshold Bit Score: 393.916
Threshold Setting Gi: 157826503
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157829195   1 MIRFITIPDFADYQVILKLMEDYVNKVINDHEPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
157804269   1 MVQFVTIPNLTDYQVTLKLMQNYVNKVINVNEPEIVYLVEHSEVYTAGTNYKQEELLNYSDIPVIYTGRGGKFTFHGPGQ 80 
157826368   1 MLQFITIPNLMDYRVTLKLMEDYVNKVISDNELEVVYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
157826503   1 MVQFITIPTPIDYQDSLMLMEDYVNKVIDGEAPEAVYLVEHLDVYTAGTNYKQEELLNHNNIPVIYTGRGGKFTFHGAGQ 80 
91204867    1 MVQFITIPTPIDYQDSLMLMEDYVNKVIDGEAPEAVYLVEHLDVYTAGTNYKQEELLNHNNIPVIYTGRGGKFTFHGAGQ 80 
15604705    1 MIRFITLQNLMDYQVTLKLMEDYVNKVINDNEPEIVYLVEHSEVYTAGTNYKQEELLNYDDIPVIYTGRGGKFTFHGPGQ 80 
15893280    1 MIRFITIPDFADYQVTLKLMEDYVNKVISDHKPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
67459775    1 MLQFITIPNLMDYRVTLKLMEDYVNKVISDNEPEIVYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
51474044    1 MIKFITLQNLMDYQVTLKLMEDYVNKVINYNEPEIVYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
165933920   1 MIRFITIPDFADYQVILKLMEDYVNKVINDHEPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
157965009   3 MIRFITIPDFADYQVTLKLMEDYVNKVISDHEPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 82 
229587250   1 MIRFITIPDFADYQVTLKLMEDYVNKVISDHEPEIIYLVEHLEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
238651122   1 MIRFITIPDFADYQVILKLMEDYVNKVISDHEPEIIYLVEHSEVYTAGTNYKQEELLNYGDIPVIYTGRGGKFTFHGPGQ 80 
157829195  81 RVIYPILNLDSPNRYKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 160
157804269  81 RVIYPILNLASPNRSKDLKLYIKMLEEWIINSLNYFGIKAYLIKDKVGIWVKVRKDEFAKIAAIGIRVRKWVTYHGVAIN 160
157826368  81 RVIYPILNLASPNRHKDLKLYIRMLEEWIINSLNYFGIKAYLIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVSIN 160
157826503  81 RVIYPILNLALPNRTKDLKLYVRMLEEWIINSLDIFGIKAYIIKNKVGIWVKTNDDIPSKIAAIGVRVRKWVTYHGIAIN 160
91204867   81 RVIYPILNLALPNRTKDLKLYVRMLEEWIINSLDIFGIKAYIIKNKVGIWVKTNDDIPSKIAAIGVRVRKWVTYHGIAIN 160
15604705   81 RVIYPILNLALPNRHKDLKLYIKMLEEWIINSLNYFGIKGYLIKDKVGIWIKVNKGEFAKIAAIGVRVRKWVTYHGIAIN 160
15893280   81 RVIYPILNLASPNRHKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 160
67459775   81 RVIYPILNLASPNRHKDLKLYIKMLEEWIINSLNYFGIKTYIIKDKVGIWVKVRKGEFAKIAAIGVRVRKWVTYHGVAIN 160
51474044   81 RVIYPILNLALPNRHKDLKLYIKMLEEWIINSLNYFGIKGYLIKDKVGIWIKVSKGEFAKIAAIGVRVRKWITYHGVAIN 160
165933920  81 RVIYPILNLDSPNRYKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 160
157965009  83 RVIYPILNLASPNRHKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWAKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 162
229587250  81 RVIYPILNLASPNRHKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 160
238651122  81 RVIYPILNLDSPNRHKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKDEFAKIAAIGVRVRKWVTYHGVAIN 160
157829195 161 ISTDLSKFSGIIPCGLENSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK 209
157804269 161 ISTDLSKFGGIIPCGLENSLVTSLNQLGVHIEMSEFDKIIQTEFNKIFT 209
157826368 161 ISTDLSKFRGIIPCGLENSLVTSLNQLGIHIEMSEFDKIIQNEFNKIFK 209
157826503 161 ISTDLSKFNGIIPCGLENSLVTSLNQLGVYIEMTEFDKILEVEFIKIFK 209
91204867  161 ISTDLSKFNGIIPCGLENSLVTSLNQLGVYIEMTEFDKILEVEFIKIFK 209
15604705  161 ISTDLCKFNGIIPCGLESSLVTSLNQLGIYVEMSEFDKIIQTEFNKIFK 209
15893280  161 ISTDLSKFSGIIPCGLENSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK 209
67459775  161 ISTDLSKFSGIIPCGLENSLVTSLNQLGIHIEMSEFDKIIQTEFNKIFK 209
51474044  161 ISTDLCKFNGIIPCGLESSLVTSLNQLGIYVEMFEFDKIIQTEFNKIFK 209
165933920 161 ISTDLSKFSGIIPCGLENSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK 209
157965009 163 ISTDLSKFSGIIPCGLENSLITSLNQLGIHVEMSEFDKIIQTEFNKIFK 211
229587250 161 ISTDLSKFSGIIPCGLENSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK 209
238651122 161 ISTDLSKFSGIIPCGLEDSLVTSLNQLGIHVEMSEFDKIIQTEFNKIFK 209
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap