Conserved Protein Domain Family
PRK14337

?
PRK14337: PRK14337 
(dimethylallyl)adenosine tRNA methylthiotransferase; Provisional
Statistics
?
PSSM-Id: 172813
View PSSM: PRK14337
Aligned: 10 rows
Threshold Bit Score: 848.632
Threshold Setting Gi: 239906359
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218886426   1 MSDRTFHILTFGCQMNVNDSDWLARALVARGFTEAPLGKARVNIVNTCSVRDKPEQKVYSVLGRIRQATRKLPDAFAVVG 80 
120603047  28 MHDRTFHIETFGCQMNVNDSDWLARALMERGFSPAPFGEARLTIVNTCSVRDKPEQKVYSLLGRIRQATGKKPDAFVAVG 107
78357421    1 MHERTFHIMTFGCQMNVNDSDWLARALEARGFTQVPEHEAAIYIINTCSVRDKPEQKVYSLLGRIRRETKNRRNVTVCVG 80 
94987263    1 MLQRNFHIITFGCQMNTNDSFWLSCSLQKKGFQEVSLEDASIIIINTCSVREKPEQKVYSILGKIRHATKNNPDSFVVIA 80 
46579397    1 MHDRTFHIETFGCQMNVNDSDWLARALMERGFSPAPFGEARLTIVNTCSVRDKPEQKVYSLLGRIRQATSKKPDAFVAVG 80 
220904542   1 MIEKSYHIITFGCQMNVHDSQWLGRALTARGFVEASLEDAQVVVVNTCSVREKPEQKVMSALGRIRHVTGGNPDVLVGVA 80 
239906359   1 ---MKFHVTTMGCQMNVGDGDWLARSLIAAGFTQAPEAEAECFILFTCSVRDKPEQKVVSEIGRIADRNRHNPNAFIAVG 77 
242279951   1 ---MKFTVLTFGCQMNVHDSDWLIRAMESRGWTAVEESEADIFIINTCSVRDKPEQKVYSVLGRLAPLC-KNPGSFVAVG 76 
258405711   1 ---MRFHIITHGCQMNVCDSDWLHRALVDLGGEPADEESAEVFVVNTCSVREKPEQKVYSLLGRLQGYWQRNPNVFVAVG 77 
256828394   1 ---MRFHILTFGCQMNVADADWLTQSLVSRGWTEAGESDAQVFVVTTCSVREKPEQKVYSLLGRLKSYADRSPDVFVAVG 77 
218886426  81 GCVAQQIGSGFFTRFPQVRLVFGGDGSSMAPQAIERLCAEPGLRLSLLDFSEEYPERDA----------QLDAGPVPPSA 150
120603047 108 GCVAQQIGSGFFSRFPQVRLVFGTDGLAMAPQALDRLVEEPDLKLSLLDFSEDYPERDA----------VLGQGAVPASV 177
78357421   81 GCVAQQIGKGFFKRFSQVRLVFGTDGAASAPQAIERLVQEPHARISLLDFSEEFPERDA----------GWENGEVPVSA 150
94987263   81 GCVAQQLGATFFEKFPQVRLVSGSDGIAMAPDAIERLYAEPDLKLNLTDFSEYYPEREYafs----kltLSNNNTLALMA 156
46579397   81 GCVAQQIGSGFFSRFPQVRLVFGTDGLAMAPQALDRLVEEPDLKLSLLDFSEDYPERDA----------VLGQGAVPASV 150
220904542  81 GCVAQQLGEGFFSKESQVRLVAGSDGISGAPAAIERLLEEPTLHLSLLDFTSHYIEREAg--------pGTSGSSSGPVA 152
239906359  78 GCTAQQLGTTLWRRFPMVRLVFGTDGIAAAPRALARLAEEPQLRLSLLDFSEAYPERDQ----------SWPDDKLPPKA 147
242279951  77 GCVAQQIGDGFLEKFPHVRLVFGSDGIAQAPDALVDLAANHEKRLVLTDFLGDYPEREGgevqpnadliPPGIGTIPGQA 156
258405711  78 GCVAQQVGTRFWKRFPHVRLVFGTDGIAMVPQAVDRLRSDPQLRLSLLDFEEHYPEREQ----------LWPEAEVPAQA 147
256828394  78 GCVAQQIGEEFWNRFPFVRLVFGTDGTAMVPQALERLANDPALRISLLDFLDHYPEREQ-----------PEGGTVQAQA 146
218886426 151 FVNIMQGCDNFCAYCIVPYTRGRQKSRAADAVVRECAELVERGAKEITLLGQNVNSYGQDAeaarqatvagDGNAVTFAE 230
120603047 178 FVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRALLDRGAREITLLGQNVNSFGQDS----------HGDGTTFAQ 247
78357421  151 YVNIMQGCNNFCAYCIVPYTRGRQKSRSSAAVLDECRTLVGNGAREITLLGQNVNSYGLDP----------HGDGTTFAR 220
94987263  157 YVNIMQGCDNYCTYCIVPYTRGKQKSRSVQAIVEECQQLIDSGVKEIVLLGQNVNAYGLDKdk------nsPANGVNFAM 230
46579397  151 FVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRALLDRGAREITLLGQNVNSFGQDS----------HGDGTTFAQ 220
220904542 153 FVNIMQGCDNFCAYCIVPFTRGRQKSRSAAAILDECRAVLERGAREITLLGQNVNAFGQDK----------SGDGTSFAQ 222
239906359 148 FVSIMQGCDNYCAYCIVPFVRGRQKSRPLPSVIAECQSLASRGVREVTLLGQNVNSYGLDD----------AGDGASFAK 217
242279951 157 FVNIMQGCDNFCAYCIVPYTRGRQKSRSSEAVIKECAHLVKSGVREITLLGQNVNSFGIDK----------KGEDISFAQ 226
258405711 148 FVNIMQGCDNYCAYCIVPYTRGRQKSRSSAAVLQECRELARRGAREITLLGQNVNSYGQDA----------NGDGTSFAA 217
256828394 147 FVNIMQGCDNFCAYCIVPFTRGRQKSRSSDAVVAECEALVRRGARELTLLGQNVNSYGQDK----------HGDGTSFAS 216
218886426 231 LLHRVAALPGLARLRFVTPHPKDIAPEVIDAFGTLDNLCPRLHLPMQSGSDRILKAMGRKYDMARYMDIVHRLKAARPDI 310
120603047 248 LLHKVAALPGLERLRFVTPHPKDIAPEVVEAFGTLPNLCPRLHLPLQAGSDRILKLMGRRYDMARYLRIVDDLRAARPDI 327
78357421  221 LLHDVAAIPGLERLRFMTPHPKDIAGEVIEAFGALKNLCPRVHLPLQSGSDRVLKAMGRKYDMARYMDIVTRLKAVRPDI 300
94987263  231 LVHTIASLPGLERLRFFSAHPKEFSSELIDLFGEFSTLCPRLHLPLQSGSDKILRRMGRKYSMDEYISIITKLKKVRPDI 310
46579397  221 LLHKVAALPGLERLRFVTPHPKDIAPEVVEAFGTLPNLCPRLHLPLQAGSDRILKLMGRRYDMARYLRIVDDLRAARPDI 300
220904542 223 LLRQVAGLPGLERLRYVTPHPKDMGPEDVAAFAELPQLCPRLHLPLQAGSDVVLRSMRRRYDSAAFLRLVDDLRAARPDL 302
239906359 218 LLDAVAAVPGIERIRFTTSHPKDLSDEVIERFAALPQLCPALHLPVQSGSDDILRRMGRRYDTAAYLTLVEKLRRACPDI 297
242279951 227 LLYKISAIEGLERIRFTTSHPKDIAPEVIKAFGELPNLCPSLHLPVQSGSDRILKKMGRKYDRERYLGIVEGLKEACPNI 306
258405711 218 LLEQVCAIPGIEQVRFTTSHPKDIAPEVIAAFGRLPELSPHLHLPLQSGSDRILKAMRRRYTRQRYLDIVTGLRQARPEI 297
256828394 217 LLERISAIPGLMRLKFTTSHPKDIAPEVVTAFGKLPNLCPQLHLPVQSGSDAVLKAMGRKYTRARYLDTIRELRRVCPQI 296
218886426 311 QLSTDIIVGFPGETEQDFEDTLSAMRAVGFAASFSFCYSDRPGTRAEMLPGKLDAAEKAARLARLQEWQNDYTEQCLRNM 390
120603047 328 VLSSDIIVGFPGETEEDFMETMGALETVGYAASYSFCYSDRPGTRAEMLPDKLSREVKLERLERLQTLQNRLTERCLQDM 407
78357421  301 QITSDLIVGFPGETEADFEQTLEAMRTVPFVQSFSFIYSDRPGTRAEMLPGKLSREEKTARLVRLQEVQNEYSEAALQAM 380
94987263  311 ALSTDFIVGFPGETEEDFLQTLQSINTIKFMSSFSFCYSDRPGTRSSTFSNKVDHEVKIKRLEQLQATQLEHSTSWLKSR 390
46579397  301 VLSSDIIVGFPGETEEDFMETMDALETVGYAASYSFCYSDRPGTRAEMLPDKLSREVKLERLERLQTLQNRLTERCLQDM 380
220904542 303 ALSTDLIVAFPGETEEDFQDTLAMMRACNFMSSFSFIYSDRPGARAALFPGKIAPDVAQDRLRRLQALQDDLGARWLAAR 382
239906359 298 ALTSDFIVGFPGETRADFEATLELVRKVGFDSGFSFMYSDRPGTASEKLAPKILPEEKSARLAELQALLDERLAASLAAR 377
242279951 307 SLTTDLIVGFPGETDEDFEQTMDMLERVRYESSFSFKYSDRPGVAAVKMKPKVPEDVAQARLARLQERQKRITRKSLEAL 386
258405711 298 TLTTDLIVGFPGETEADFEQTLEMMREVGFASSFSFKYSDRPGVAAEQMEDKVPEEIKSHRLQRLQSLQEELTGEALQAE 377
256828394 297 TLTTDIIVGFPGETLQDFEDTLELMREVRYESSFSFKYSDRPGVRAEKMDFKVPEEEKSRRLAVLQEMQDRITVEELAAQ 376
218886426 391 VG--LHTMVLLDGMSRKPGmatpeshegvhdgatgtPGGESWQGRDPYGQAVNVVMP---PRTEGGpegwlGRIVPVTIV 465
120603047 408 VG--KKVEVLLEGMSRKPG-----------------DEGDSWQGRDPYGNLVNVALP---QGSDVR-----GRFLPVVVA 460
78357421  381 VG--KTVMVLFESPSPKSAagsgtdaq--naaeesgRTASSWQGRDEHGFILNVHLP---APADLY-----GKIMPVTVT 448
94987263  391 VG--VETTVLLEKVSRKKA-----------------EDNNSWQGRDPWGNVVNVILP---QSTNIS-----NTLLPVRII 443
46579397  381 VG--RKVEVLLEGMSRKPG-----------------DEGDSWQGRDPYGNLVNVALP---QGSDVR-----GRFLPVVVA 433
220904542 383 VEnrDKTTLLMEGPSPKPGe----------------SAEPSWQGRDPYGVPVHVPLP---AGADHT-----GFLVQTVIT 438
239906359 378 LG--RREVVLIEGESRREG-----------------TLGATWRGRDPGGRVVNVPLP---AGADYA-----GRFVAVRIV 430
242279951 387 EG--HETVVLLERLSKRQE-----------------EGGMTWRGKDPGGRVVNVHFAgygEEQKLG-----GKLVKVKIT 442
258405711 378 VG--RHVTVLLREPGRQDG------------------GGVIWRGRDPGGRVVNCRTE---LDSALI-----GSYVGVRVT 429
256828394 377 VG--SMAEVLVEGPSKMQD-----------------SEYIFWRGRDGGGRIVNFSSP---I-PCLT-----GRMVRVRIV 428
218886426 466 EAKKHSLRGVLRA 478
120603047 461 QAKKHSLLAEQAG 473
78357421  449 AARKHSLTGEPAG 461
94987263  444 ASKKHSLVAEPLI 456
46579397  434 QAKKHSLLAEQAG 446
220904542 439 EAKKHSLLAVRTG 451
239906359 431 QAKKHSLVGEAEA 443
242279951 443 EAKNHSLVGAKVG 455
258405711 430 EAKKHSLFGEVET 442
256828394 429 DAKKHSLVGEIRG 441
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap