Conserved Protein Domain Family
PRK14332

?
PRK14332: PRK14332 
(dimethylallyl)adenosine tRNA methylthiotransferase; Provisional
Statistics
?
PSSM-Id: 172808
View PSSM: PRK14332
Aligned: 6 rows
Threshold Bit Score: 890.102
Threshold Setting Gi: 189911292
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189911292   8 SQTLTPTIQLGKVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKIYGRLQSLGYLKKKN 87 
24213805    1 MSVLEQEKKSGKVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKIYNRLQSLGYLKKRN 80 
45658409    1 MSVLEQEKKSGKVYIETYGCQMNEYDSGIVSSLMRDAEYSTSSDPENSDIIFLNTCAIRENAHAKIYNRLQSLGYLKKRN 80 
116330557   1 MGVLEREKKTGKVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKIYNRLQSLGYLKKRN 80 
116327643   1 MGVLEREKKTGKVYIETYGCQMNEYDSGIVSSLMKDAEYSSSPDPENSDIIFLNTCAIRENAHAKIYNRLQSLGYLKKRN 80 
183221201   8 SQTLTPTIQLGKVYVETYGCQMNEYDSGIVKELFRKEHYETTNVVEESDIIFLNTCAVRENAHAKIYGRLQSLGYLKKKN 87 
189911292  88 PNLVIGVLGCMAQNLGEDLFHQELPLDLIVGPDNYRTLPELIQNIRNGEKDVQLTRLSRSETYDELEPKVVNGIQAFVTI 167
24213805   81 PNLVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRKGENSISLTRLSKIETYDEIEPRVVNGIQAFVTI 160
45658409   81 PNLVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRKGENSISLTRLSKIETYDEIEPRVVNGIQAFVTI 160
116330557  81 PELVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRSGEHSISLTRLSKIETYDEIEPRVVNGIQAFVTI 160
116327643  81 PELVIGVLGCMAQNLGDDLFHQELPLDLVVGPDNYRSLPELIQRIRSGEHSISLTRLSKIETYDEIEPRVVNGIQAFVTI 160
183221201  88 PNLVIGVLGCMAQNLGEDLFHQELPLDLIVGPDNYRTLPELIQNIRNGEKDVQLTRLSRSETYDELEPKVVNGIQAFVTI 167
189911292 168 MRGCNNFCTFCVVPYTRGRERSREPKSIIHEIKQLQEMGVKQVTLLGQNVNSYSYESYDFCALVESILKETTIERVRFTS 247
24213805  161 MRGCNNFCTFCVVPYTRGRERSRDPKSIVREVQDLVQKGIRQITLLGQNVNSYKEQDTDFAGLIQMLLDETSIERIRFTS 240
45658409  161 MRGCNNFCTFCVVPYTRGRERSRDPKSIVREVQDLVQKGIRQITLLGQNVNSYKEQDTDFAGLIQMLLDETSIERIRFTS 240
116330557 161 MRGCNNFCTFCVVPYTRGRERSRDPKSIVREIQDLTEKGIRQVTLLGQNVNSYKEQGTDFAGLIQMLLDETTIERIRFTS 240
116327643 161 MRGCNNFCTFCVVPYTRGRERSRDPKSIVREIQDLTEKGIRQVTLLGQNVNSYKEQGTDFAGLIQMLLDETTIERIRFTS 240
183221201 168 MRGCNNFCTFCVVPYTRGRERSREPKSIIHEIKQLQEMGVKQVTLLGQNVNSYSYESYDFCALVESILKETTIERVRFTS 247
189911292 248 PHPKDFPDHLISLMAKEDRFSSQIHMPLQAGSSKVLRDMKRSYTKEEYLDLVKKIQSVIPDIGITSDIIVGFPGETEEEF 327
24213805  241 PHPKDFPTHLLQLMSENPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVKEIRNIVPDVGITTDIIVGFPNETEEEF 320
45658409  241 PHPKDFPTHLLQLMSENPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVKEIRNIVPDVGITTDIIVGFPNETEEEF 320
116330557 241 PHPKDFPVRLLRLMAQNPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVREIRNIVPDVGITTDIIVGFPNETEEEF 320
116327643 241 PHPKDFPVRLLRLMAQNPRFCPNIHLPLQAGNTRVLEEMKRSYSKEEFLDVVREIRNIVPDVGITTDIIVGFPNETEEEF 320
183221201 248 PHPKDFPDHLISLMAKEDRFSSQIHMPLQAGSSKVLRDMKRSYTKEEYLDLVKKIQSVIPDIGITSDIIVGFPGETEEEF 327
189911292 328 LETLEVVKKVKFDMSYMFKYSEREGTIAKRKFIDDVPEEVKSRRLIELVELQTKISLEKNTSKIGKIFSILIENTSKKSK 407
24213805  321 EDTLAVVREVQFDMAFMFKYSEREGTMAQRKLPDNVPEEVKSARLTKLVDLQTSISHEQNRARIGRVYSILIENISRKSE 400
45658409  321 EDTLAVVREVQFDMAFMFKYSEREGTMAQRKLPDNVPEEVKSARLTKLVDLQTSISHEQNRARIGRVYSILIENISRKSE 400
116330557 321 EDTLAVVREVQFDMAFMFKYSEREGTMARKKLPDNVSEETKSARLTKLVDLQTSISHEQNRARIGRVYSILIENTSRKSE 400
116327643 321 EDTLAVVREVQFDMAFMFKYSEREGTMARKKLPDNVSEETKSARLTKLVDLQTSISHEQNRARIGRVYSILIENTSRKSE 400
183221201 328 LETLEVVKKVKFDMSYMFKYSEREGTIAKRKFIDDVPEEVKSRRLIELVELQTKISLEKNTSKIGKIFSILIENTSKKSK 407
189911292 408 QELCGRSHCGRMVVFPIPEGmsQDLSDWIGKTVNVLIEQATSATLKGKLIV 458
24213805  401 KQLCGRTPCGRMTVFPLPQE--TNVSGMIGSTVSVQIESATSATLKGRILA 449
45658409  401 KQLCGRTPCGRMTVFPLPQE--TNVSGMIGSTVSVQIESATSATLKGRILA 449
116330557 401 KQLCGRTPCGRMTVFPLPEG--RSASEMIGSTVSVRIESATSATLKGGILS 449
116327643 401 KQLCGRTPCGRMTVFPLPEG--RSASEMIGSTVSVRIESATSATLKGGILS 449
183221201 408 QELCGRSHCGRMVVFPIPEGmsQDLSDWIGKTVNVLIEQATSATLKGKLIV 458
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap