Conserved Protein Domain Family
glmM

?
PRK14321: glmM 
phosphoglucosamine mutase; Provisional
Statistics
?
PSSM-Id: 172797
View PSSM: PRK14321
Aligned: 7 rows
Threshold Bit Score: 858.778
Threshold Setting Gi: 242398177
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
212224596   1 MGKYFGTSGIREIVNEKLTPELALNVGRALGTYLGGGTVVVGRDTRTSGGMLKRALISGLLSTGVDVIDIGLAPTPLTGF 80 
57642120    1 MGKYFGTSGIREVFNEKLTPELALKVGKALGTYLGGGKVVIGKDTRTSGDVIKSAVISGLLSTGVDVIDIGLAPTPLTGF 80 
18977233    1 MGKYFGTSGIREVVNEKLTPELALKVGLALGTYLGEGRVVVGIDTRTSSEMIKHALVSGLLATGIEVVDIGLAPTPLTGF 80 
14521265    1 MGKYFGTSGIREVVNEKLTPELALKVGLALGTYLNGGRVVIGNDTRTSSEMLKKAVISGLLASGVDVIDIGLAPTPLVGF 80 
14591031    3 MGRYFGTSGIREVVNEKLTPELALKVGLALGTYLQEGKVVIGCDTRTSSVMLKNAVISGLLATGIDVIDIGLAPTPLTGF 82 
240104152   1 MGRYFGTSGIRGLFNECVTPELALKVGKAVGTYLGGGRVVVGMDTRTSSETLKSALISGLLSTGVEVIDIGLAPTPLTGF 80 
242398177   6 MGKYFGTSGIREVVNERLTPDLALKVGKALGTYLGEGKVVVGKDTRTSGEMLKNALISGLLSTGVDVIDIDLSPTPLTGF 85 
212224596  81 AIKLYGADAGVTITASHNPSQYNGIKVWQPNGMAYTPEMENQLEAIIDSGNFRKAAWNEIGKVRTADPKEEYLREALRIV 160
57642120   81 AIKLYGADAGVTITASHNPPEYNGIKVWQANGMAYTSEMERELESIMDSGNFKKAPWNEIGTLRRADPSEEYINAALKFV 160
18977233   81 AIKLYNADAGVTITASHNPPNYNGIKVWDRNGMAYTPDKESELERIIEEETFKRVSWMEIGEVIKADPKKEYIKNAVEQI 160
14521265   81 AIKLYDADAGVTITASHNPPEYNGIKVWDRNGMAYTPEKERELERIIEEEKFKRAPWNEIGQLKQANPREEYIEAIMKEI 160
14591031   83 AIRLYNAEAGVTITASHNPPQYNGIKVWDRDGMAYTPDKEHELEKIIESGNFRRVPWNEVGTLKTANPRKEYIEAILREI 162
240104152  81 AIKLYEADAGVTITASHNPPEYNGIKVWQSNGMAYTPDMEAELERILESGNFRKVPWNEIGTLRRADPREEYIRKALEMV 160
242398177  86 AIKLYEADAGVTITASHNPPEYNGIKVWQPNGMAYTSEMENELERILEKGKFQQVSWNDIGELTRADPKKEYIKKALEMI 165
212224596 161 HLDNSYTVVIDSGNGAGSILSPYLQRELGNKVISLNSHPSGFFVRELEPNAKSLAMLAKTVKAMKADVGIAHDGDADRIG 240
57642120  161 KLENSYTVVLDSGNGAGSVVSPYLQRELGNRVISLNSHPSGFFVRELEPNAKSLSALAKTVRVMKADVGIAHDGDADRIG 240
18977233  161 NLENSYTVVVDSGNGAGSIVSPYLQRELGNKVISLNSHPTGFFVRELEPNRKSLDMLSKVVREVGADVGIAHDGDADRIG 240
14521265  161 KLDNSYTVVIDPGNGAGSIISPYLHRELGNRVITINSDPHGFFVRELEPNKESLSMLAKTVKALKADIGIAHDGDADRVG 240
14591031  163 NLKGSYTVVIDAGNGAGSIVSPYLHRELGNRVITLNSDPSGFFVRELEPNKESLSMLEKTVKVLNADIGIAHDGDADRVG 242
240104152 161 KLNDSYTVVVDSGNGAGSILSPYLQRELGNKVISLNSHPSGFFVRELEPNAKSLSGLAKTVRVMKADVGIAHDGDADRIG 240
242398177 166 ELSKGYKVVVDCGNGAGSILSPYLQRELGNKVVSLNSHPSGFFVRELEPNAKSLLALSKAVKSLGADVGIAHDGDADRIG 245
212224596 241 VVDDQGNFVEYEVMLSLIAGYMLRKFGKGKVVTTVDAGFALDDYIKPLGGEVLRTRVGDVAVADELAKHGGIFGGEPSGT 320
57642120  241 VVDDQGNFVEYEVMLSLIAGYMLRKFGKGKIVTTVDAGFALDDYLRPLGGEVIRTRVGDVAVADELAKHGGVFGGEPSGT 320
18977233  241 VVDDQGNFVDYEVMLSLIAGYMIEKYGKGKVVTTVDAGFALDDYLKPRGGEVIRTKVGDVAVAYELSKHGGVFGGEPSGT 320
14521265  241 VVDENGEFVEYEVMLSLIAGYMLRKYGKGKVVTTVDAGFALDDYVRGLGGEVVRTRVGDVAVAEELMKHGGVFGGEPSGT 320
14591031  243 VVDENGEFVEYEVMLSLIAGYMLKKYGKGKIVTTVDAGFALDDYIRELGGEVVRTRVGDVAVAEELVKHGGVFGGEPSGT 322
240104152 241 VVDDEGNFVEYEVMLSLIAGYMLRKFGKGKIVTTVDAGFALDDYVRPLGGEVIRTRVGDVAVADELAKHGGIFGGEPSGT 320
242398177 246 VIDDQGNFVEYEVMLSLISSYMLRKFGKGKIITTVDAGFALDDYIKPLGGEVARVKVGDVAVAEGIVRENAVFGGEPSGT 325
212224596 321 WIIPQWNLTPDGIFAGALVLEMIDRLGPISELAKEVPRYVTLRAKIPCPNGKKARAMEIIAHEALKSFDYERLIDIDGVR 400
57642120  321 WIIPQWNLTPDGIFAGALVLEMIDRLGPISELAKEVPRYVTLRAKIPCPNEKKAKAMEIIAREALKTFDYEGLIDIDGIR 400
18977233  321 WIIPQWNLTPDGIFAGALVVEMIDKLGPISELAKEVPRYVTLREKIPCPNELKQKVMRIIEKLALQNFEYKNLIDIDGIR 400
14521265  321 WIMPQWNLTPDGIFAGALVLEMIDRLGLIGELAKEVPRYVTLRKKIPCPNDLKAKAMEEIAKLIPREFSYEREITIDGIR 400
14591031  323 WIMPQWNLTPDGIFASALVLEMIDRLGPIGELAKDVPKYVTLRKKIPCSNELKNKVMNKIADLIPREFSYERIITIDGIR 402
240104152 321 WIIPQWNLTPDGIFAGALVLEMIDRLGPISELAREVPRYVTLRAKVPCPNEKKAKAMEIIAKEALKSFDYEKLIDIDGIR 400
242398177 326 WIIPQWNLTPDGIFAGVLVLEMIDKLGPLSEIAKGVPRYVTLRAKIPCPNEKKAKAMEFIKREVLENFEYKRIIDIDGIR 405
212224596 401 IENGDWWILFRPSGTEPIMRITLEAHTEEKAKELMEKAERLVKEAIARA 449
57642120  401 IENGDWWILFRPSGTEPIMRITLEAHEEEKAKELMGKAERLVKKAISEA 449
18977233  401 IENEEWWILFRPSGTEPIMRITLEAHTKEKAEELMKKARGLVKEAIEKA 449
14521265  401 IENDDWWILFRPSGTEPIMRITLEAHTKERAESLMEKAEKLVKDAIKKA 449
14591031  403 IENDDWWILFRPSGTEPIMRITLEAHTEEMAERLMKKAENLVKSVIKDL 451
240104152 401 IENSDWWILFRPSGTEPIMRITLEAHTEDKAKELMEKAEKLVKEAVRRA 449
242398177 406 IENDEWWILFRPSGTEPIMRITLEAHTKKKAEELMEKAEEVVKRAIKSV 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap