Conserved Protein Domain Family
glmM

?
PRK14320: glmM 
phosphoglucosamine mutase; Provisional
Statistics
?
PSSM-Id: 172796
View PSSM: PRK14320
Aligned: 9 rows
Threshold Bit Score: 871.245
Threshold Setting Gi: 118498194
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
156503253   1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
118498194   1 MAKYFGTDGIRGEVANSTITAEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
134301293   1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
110669728   1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
115315399   1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
89257044    1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
56707258    1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
187931035   1 MAKYFGTDGIRGEVANSTITVEFTQKLGNAVGSLINQKNYPKFVIVGQDTRSSGGFLKFALVSGLNAAGIDVLDLGVVPT 80 
167627200   3 VAKYFGTDGIRGEVGKSVIKAEFMQKLGNAVGTLINDNGYPGFVIIGQDTRSSGKFLKFALVSGLNAAGIDVIDLGVVPT 82 
156503253  81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
118498194  81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
134301293  81 PVVAFMTVKYRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
110669728  81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
115315399  81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
89257044   81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
56707258   81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
187931035  81 PVVAFMTVKHRAAAGFVITASHNKFTDNGIKLFSSNGFKLDDALEEEVEDMIDGDFIYQPQFKFGSYKILANAIDEYIES 160
167627200  83 PIVAFMTVKYKAAAGFVITASHNKFTDNGVKLFSSSGFKLDDALEEEVEAKIDSDFIYQTECKFGNYKVAENFIDEYIEN 162
156503253 161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
118498194 161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGIDYVSIASNPDGLNINVGCGATCISNIKKAVKEQKADLGISLDG 240
134301293 161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
110669728 161 IYSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
115315399 161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
89257044  161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
56707258  161 IYSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
187931035 161 IHSRFAKFVNYKGKVVVDCAHGAASHNFEALLDKFGINYVSIASNPDGLNINVGCGATCVSNIKKAVKEQKADLGISLDG 240
167627200 163 LFERFGSLVNYKGKVVIDCANGAASNHFEALLDRFCIDYISVASNPDGLNINVDCGATCTSNIKKAVIEHNADLGISLDG 242
156503253 241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
118498194 241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
134301293 241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
110669728 241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
115315399 241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
89257044  241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
56707258  241 DADRIIIVDENGQEIDGDGILNILAQYSDICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
187931035 241 DADRIIIVDENGQEIDGDGILNILAQYSNICGGTNGIVGTQMTNMSYENHYRANKIPFIRSKVGDRYVLEDLVKYGYKIG 320
167627200 243 DADRIIIVDENAQEIDGDGILNIIAQYSNICGGTTGIVGTQMTNMSYENHYKSNNIPFIRSKVGDRYVLEDLVKHGYKIG 322
156503253 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQAYKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
118498194 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLAKKVTREDLQKVASDVNDVEKRLGN 400
134301293 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
110669728 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
115315399 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQAYKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
89257044  321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQAYKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
56707258  321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
187931035 321 GESSGHVINLNFGTTGDGLFTAIQLLAIFSQADKPVSEFKLQGELMQQTLINVPLTKKVAREDLQKVASDVNDVEKRLGN 400
167627200 323 GESSGHVINLNFGTTGDGLSTAIQLLAIFSQSDKPVSAFKLPGELMQQTMINVPLNFKVTSDHLAKLAGDVAKAEERLGS 402
156503253 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
118498194 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
134301293 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
110669728 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
115315399 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
89257044  401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
56707258  401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
187931035 401 RGRVLLRPSGTEPVLRVMVEADDKSLATNEAEYLVEKVKQKLV 443
167627200 403 RGRVLLRPSGTEPVLRVMVEADTKDLATKEAEYLVEKVKQKLV 445
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap