Conserved Protein Domain Family
glmM

?
PRK14319: glmM 
phosphoglucosamine mutase; Provisional
Statistics
?
PSSM-Id: 172795
View PSSM: PRK14319
Aligned: 3 rows
Threshold Bit Score: 789.837
Threshold Setting Gi: 150021297
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154249581   1 MRLFGTDGIRGVVNEELTPEIAFKLGNALAKYVDKRIFIAKDTRASGDMLEAALVAGATSAGATVYRCGVLPTPALAVIT 80 
217077794   1 MRYFGTDGIRGVVNEFLTPELAFRLGNAVGNMVNGKVFIAKDTRNSGDMLEAALIAGITSAGADVYRCGIMPTPALALIT 80 
150021297   1 MKLFGTDGIRGIVNEFLTPEIAFRLGNVLGNMVDKKIFIAKDTRASGDMLEEALVAGITSAGVDAYKCGVLTTPALALIT 80 
154249581  81 KLEDAIGVMISASHNPPEFNGLKVLSRGFKLPDEVEETLEKRMNEIHYSPYNEIGCVVDYKLAFEEYTNYIVQQFEGLDL 160
217077794  81 KLEDAAGIMISASHNPPEYNGLKVIMKGYKLPDSLEERIENEMQNVKYNSFEKVGRVIDYRLAEEEYFNYIKELYKNLDL 160
150021297  81 RLENAAGVMISASHNPPEYNGLKVLMRGYKLPDDIEERIEREMEKIRYCEYKSVGKVIEYDFASEEYFEYIKKQYSFLDL 160
154249581 161 TGLKILVDAGNGAAYETTPYILRELGAKVDVIYNTPDGYNINVDCGSTNPKKALEKMTNHNLAILHDGDADRCILLDEKK 240
217077794 161 SGIKIVMDVANGATFNLNPKILEYFGAKIEVVNNEPDGFNINKDCGSTHPENIKNYIVNGKIGILHDGDGDRCIFLDENG 240
150021297 161 SGIKLVVDVANGATYKLNPQILEYFGAKLEVVNDRPDGFNINRDCGSTHPENVKKNITGSKIAVLYDGDGDRCIFVDEKG 240
154249581 241 QEVHGDKIIGLCAKHMKLEGRLKNDVAVGTVLSNIGLEVFLKNNGIKLVRVKVGDRYVLEKMLELNASVGGERSGHVIFL 320
217077794 241 QEFHGDKIIGLTALQLKKEGRLKNDKVVVTILSNMGLERFLNENSIDVVRTKVGDRYVLEEMLKENITLGGERSGHIIYL 320
150021297 241 EEFHGDKILGITAIDLKKENRLKKNNVVLTILSNMGLEEFLKNNEINVVRTKVGDRYILEEMLKNDYTLGGERSGHIIYR 320
154249581 321 DKSTTGDGIITALETISVMIKSGKKLSELADEIPDYPQIMINVKTKNKLVVEHEEVKKLIEKYKreDVDIVVRPSGTEPL 400
217077794 321 DRSTTGDGLITALETLSAMVNSGKRLADLSNLIPDYPQVMLNVKVSDKEVYKSKEVFEKLKSIK--DYRVIVRPSGTEPV 398
150021297 321 DKSTTGDGLITTLEVLSSLVKSGLTLHDLSNRIPDYPQVMVNVEVKNKEIYKNKKVFSLMKSIK--DYRVIIRPSGTEPV 398
154249581 401 VRVFVQGPNEEYISNAAYDIAGKIEELSKGED 432
217077794 399 VRVLVEGPDMDESTIIANDIADLIKKFDNKKE 430
150021297 399 IRVLVEGPDLEKITDIANKFYELIKELDKE-- 428
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap