Conserved Protein Domain Family
PRK14300

?
PRK14300: PRK14300 
chaperone protein DnaJ; Provisional
Statistics
?
PSSM-Id: 172788
View PSSM: PRK14300
Aligned: 13 rows
Threshold Bit Score: 759.165
Threshold Setting Gi: 157825371
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91205929    1 MSQDYYQILGVSKTANSADLKKAYHKLAKQYHPDNAASGDtnAEKKFKEINAAYEVLKDEQKRAAYDRFGHDAFQNQQA- 79 
67459477    1 MSQDYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKEINSAYDVLKDEQKRAAYDRFGHDTFQYQQS- 77 
51473384    1 MSQDYYQVLGVSKTASQADIKKAYLKLAKQYHPDTTNAHD--AEKKFKEINAAYDVLKDEQKRAAYDRFGHDAFQNQQA- 77 
15892155    1 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKEINAAYDVLKDEQKRAAYDRLGHDAFQNQQS- 77 
15604058    1 MSQDYYQVLGVSKTASQADIKKAYLKLAKQYHPDTTNAND--AEKKFKEINAAYDVLKDEQKRAAYDRFGHDAFQSQQA- 77 
157803365   1 MSQDYYQILGVSKTASSAELKKAYHKLAKQYHPDNAAAGDtnAEKKFKEINAAYDVLKDEQKRAAYDRFGHDAFQNQQSr 80 
157825371   1 MSQDYYKILGVSKTASQADLKKAYLKLAKQYHPDTTDDKD--AEKKFKEINRAYDVLKDEQKRAAYDRFGHDTFQNQQS- 77 
157828112   1 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKAINAAYDVLKDEQKRAAYDRLGHDAFQNQQS- 77 
157826711   1 MSQDYYQILGVSKTANSADLKKAYHKLAKQYHPDNAAAGDtnAEKKFKEINAAYEVLKDEQKRAAYDRFGHDAFQNQQA- 79 
229586428   1 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKEINAAYDVLKDEQKRAAYDRLGHDAFQNQQS- 77 
157964249   2 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKEINAAYDVLKDEQKRAAYDRLGHDAFQNQQS- 78 
165932813   1 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKAINAAYDVLKDEQKRAAYDRLGHDAFQNQQS- 77 
238650458   1 MSQNYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDAKD--AEKKFKEINAAYDVLKDEQTRAAYDRLGHDAFQNQQS- 77 
91205929   80 RGGAGSQGGhpFGADINDIFGDFFSDFMGGGGRr-KPTSSKVRGSDLKYNLTINLEEAFHGVEKNISFSSEVKCDTCHGS 158
67459477   78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGGRR--KPTSSKARGSDLKYDLTINLEEAFHGIEKNISFSSEVKCDTCHGT 153
51473384   78 R-GGGNNSG--FHHDINDIFGDFFSDFMGSGRR--KQTSSKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDACHGT 152
15892155   78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGS 155
15604058   78 R-GGGNNGS--FHPDINDIFGDFFSDFMGSGRR--KQTSSKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDTCHGT 152
157803365  81 RGAGGGTSS--FHPDINDIFGDFFSDFMGGSRRs-RPTSSKVRGSDLKYDLTINLEEAFHGIEKNISFSSEVQCDTCHGN 157
157825371  78 RGGGGSHAG--FHHDINDIFGDFFSDFMGGGRR--KPTSSKARGSDLKYDLTINLEEAFHGIEKNISFSSEVKCDTCHGS 153
157828112  78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNINFSSAVKCNTCHGS 155
157826711  80 RGGAGSQGGhpFGADINDIFGDFFSDFMGGGGRr-KPTSSKVRGSDLKYNLTINLEEAFHGVEKNISFSSEVKCDTCHGS 158
229586428  78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGS 155
157964249  79 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGS 156
165932813  78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNINFSSAVKCDTCHGS 155
238650458  78 RGGGGNHGG--FHPDINDIFGDFFSDFMGGSRRssRPTSAKVRGSDLKYNLTINLEEAFHGIEKNISFSSTVKCDTCHGS 155
91205929  159 GSEKGETTTTCDACGGVGATRVQQGFFMIEQTCHKCQGNGQIIKNPCKKCHGLGRYHKQRNLSVNIPAGVENGTRIRHPG 238
67459477  154 GSEKGETVTTCDACGGVGATRIQQGFFTIEQACHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENATRIRHPG 233
51473384  153 GSEKGETVTTCDSCGGVGVTRIQQGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHSG 232
15892155  156 GSEKGETVTTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 235
15604058  153 GSEKGETITTCDACGGVGATRIQQGFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHTG 232
157803365 158 GSEKGETITTCDACSGVGVTRIQQGFFTIEQTCHKCQGNGQMIKNPCKKCHGMGRYHKQRNLLVNIPAGVENGTRIRHTG 237
157825371 154 GSEKGETVTTCDACGGVGATRIQQGFFTIEQACHKCKGNGQIIKNPCKKCHGMGRCHKQRNLSVNIPAGVENGTRIRHTG 233
157828112 156 GSEKGETVTTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 235
157826711 159 GSEKGETTTTCDACGGVGATRVQQGFFMIEQTCHKCQGNGQIIKNPCKKCHGLGRYHKQRNLSVNIPAGVENGTRIRHPG 238
229586428 156 GSEKGETVTTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 235
157964249 157 GSEKGETVTTCDACSGVGVTRMQQGFFTIEQACHKCQGNGHIIKKPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 236
165932813 156 GSEKGETVTTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 235
238650458 156 GSEKGETVTTCDACSGVGATRMQQGFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHKQRNLSVNIPAGVENGTRIRHTG 235
91205929  239 EGEAGIRGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVNAALGGEVAVPVIEGGKVNLTIPAGTQNGDQLRLCGKG 318
67459477  234 EGEAGIRGGNSGDLYVDIAIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPIIEGGKVNLTIPAGTQNGDQLRLRSKG 313
51473384  233 EGEAGIRGGNNGDLYVDIAIKPHDIYKIDGANLHCKLPISFVHAALGGEIEVPVIEGGKVKLTIPAGTQNGDQLRLRSKG 312
15892155  236 EGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVNLTIPAGTQNGDQLRLRSKG 315
15604058  233 EGEAGIRGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVHAALGGEIEVPVIEGGKVKLTIPAGTQNGDQLRLRSKG 312
157803365 238 EGEAGIRGGNSGDLYVDISIKPHDIYKVDGANLHCKLPISFVNAALGGEVEVPIIEGGKVNLTIPAGTQNGDQLRLRSKG 317
157825371 234 EGEAGIRGGNSGDLYVDIAITPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGRKVNLTIPAGTQNGDQLRLRSKG 313
157828112 236 EGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVSLTIPAGTQNGDQLRLRSKG 315
157826711 239 EGEAGIRGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVNAALGGEVAVPVIEGGKVNLTIPAGTQNGDQLRLCGKG 318
229586428 236 EGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVNLTIPAGTQNGDQLRLRSKG 315
157964249 237 EGEAGIRGGNSGDLYVDIAIKPHDIYKVDGAHLHCKLPISFVNAALGGEIEVPVIEGGKVKLTIPAGTQNGDQLRLRNKG 316
165932813 236 EGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVSLTIPAGTQNGDQLRLRSKG 315
238650458 236 EGEAGIRGGNSGDLYVDITIKPHDIYKVDGANLHCKLPISFVNAALGGEIEVPVIEGGKVNLTIPAGTQNGDQLRLRSKG 315
91205929  319 MSKIRSTIRGDMLAHVHVEVPKNLSKRQRELLEELRGESANEKENDGSFFNKMKSLWS 376
67459477  314 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 371
51473384  313 MSKIRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDSSFFNKMKSMWS 370
15892155  316 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 373
15604058  313 MSKVRSTIRGDMLTHIHVEVPKNLSKKQRELLEEFKKESINEKENDSSFFNKMKSMWS 370
157803365 318 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESMSEKENDSSFFNKMKSLWS 375
157825371 314 MPKMRSTIRGDMITHIHIEVPKNLSKRQCELLEEFKKESISEKENDGSFFNKMKSLWS 371
157828112 316 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 373
157826711 319 MSKIRSTIRGDMLAHVHVEVPKNLSKRQRELLEELRGESANEKENDGSFFNKMKSLWS 376
229586428 316 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 373
157964249 317 MSKMRSTIRGDMLTHMHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 374
165932813 316 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 373
238650458 316 MSKMRSTIRGDMLTHIHVEVPKNLSKRQRELLEEFKKESINEKENDGSFFNKMKSLWS 373
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap