Conserved Protein Domain Family
PRK14290

?
PRK14290: PRK14290 
chaperone protein DnaJ; Provisional
Statistics
?
PSSM-Id: 172778
View PSSM: PRK14290
Aligned: 3 rows
Threshold Bit Score: 698.606
Threshold Setting Gi: 48477913
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16082112   1 MAKDYYKILGVDRNATDEEIKKAFRELAKKWHPDLHPENKqEAEEKFKEISEAYEVLSDPQKRRMYDQTGTVDFGAgGQN 80 
48477913   1 MAKDYYAILGVDRNASQDDIKKAFRELAKKYHPDANPGNK-EAEEKFKEIAEAYEVLSDPQKRKQYDETGTTDFNA-GSG 78 
13541318   1 MAKDYYKILGVDRNASEEDIKKAFRELAKKWHPDLHPDNKaEAEEKFKEISEAYEVLSDPEKRRIYDQTGSVDFGGgGSN 80 
16082112  81 FNWDNFTHYSDLNDIFNDIFGGNFASDFFSGFGRGQreeqyDLDLYTNLDITLEDAYYGTEKRIKYRRNAMCPDCNGTGA 160
48477913  79 FNWQDFTHFDDINDIFNQFFGGNFGDTFFGGYTNQP-----DLDIYLRVNISLEDAYYGASKNVKYRRNAMCEHCSGTGA 153
13541318  81 FNWDNFTHFSDINDIFNEIFGGNFGSDFFSGFGNRQstrniDLDMYTNLDISLEEAYYGTEKRIKFRRNAICPDCKGTGA 160
16082112 161 KNGKLITCPTCNGTGQQRIVRGQGFFRMVTVTTCQTCGGRGRIPEEKCPRCNGTGTVVVNEDISVKIPKGATDNLRLRVQ 240
48477913 154 ENKVLITCPTCHGSGQERITRGQGFFRMVTVTECRTCHGRGKIPQKPCTVCHGTGTVSKNEDISVNIPKGADTNLKLRLK 233
13541318 161 KNGKLITCPTCHGTGQQRVVRGQGFFRMVTVTTCNTCGGKGRIPEEKCPRCNGTGTIVVDEDITVKIPRGATDNLRLRVS 240
16082112 241 GKGQSYNGRTGDLYVVLRVRNDRNVQRINDDLMIDQKINFAQAALGDTIEVNLFREKYSLKIPEGTQPGEVLRIKGAGMP 320
48477913 234 NMGNSYGGVTGDLYIVLIVNNPPGIRRSGQDIYVEHTIDFPEAALGGEEEIKLFRESYNLKIPAGTQPGEILKIKGAGMP 313
13541318 241 GKGQSYDGRTGDLYVILRIKQDKNLQRINDDLLLDQKINFGQAALGADIPIQIFNEKYNLKIPEGTQPGDVIKIKGAGMP 320
16082112 321 HLNGHGSGDLLVRVNVEVPKRLTQKQKDLIREIFDikENHRSWFH 365
48477913 314 RINGHGSGDLNVIIKIEVPKHLTSRQKELLEEFRN--EKKKSWFH 356
13541318 321 HLNGHGSGDLLVRINVEVPKRLTAKQRELIRELFDikENHKSWFH 365
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap