Conserved Protein Domain Family
PRK14288

?
PRK14288: PRK14288 
molecular chaperone DnaJ
Statistics
?
PSSM-Id: 172776
View PSSM: PRK14288
Aligned: 9 rows
Threshold Bit Score: 685.267
Threshold Setting Gi: 188528120
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15612317    1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLGDEKKRALYDRYGKKGLNQAGTSQ 80 
15645945    1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGASQ 80 
109946879   1 MELSYYEILEVEKHSNQETIKRSYRKLALKYHPDRNAGDKEAEERFKLINEAYGVLSDEKKRALYDRYGKQGLNQAGASQ 80 
108563702   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGASQ 80 
208435228   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGSSQ 80 
188528120   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGASQ 80 
210135489   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGTSQ 80 
254779874   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGSNQ 80 
298735643   1 MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAGDKEAEEKFKLINEAYGVLSDEKKRALYDRYGKKGLNQAGASQ 80 
15612317   81 SDFSDFFEDLGSFFEDAFGFGARGSKRQKSSIAPDYLQMIELSFKEAVFGCKKTIKAQYQSVCESCDGTGAKDKALENCK 160
15645945   81 GDFSDFFEDLGSFFEDAFGFGARGSKRQKSSIAPDYLQTLELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKALETCK 160
109946879  81 SDFSDFFEDLGSFFEDAFGFSARGSKRQKSAIAPDYLQTIKLSFKEAVFGCKKTIKVQYQSVCEVCDGTGAQDKALETCK 160
108563702  81 SDFSDFFEDLGSFFEDAFGFGARGSKRQKSSIAPDYLQMIELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKVLETCK 160
208435228  81 SDFSDFFEDLGSFFEDAFGFGSRGSKRQKSSIAPDYLQTIELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKALEACK 160
188528120  81 SDFSDFFEDLGSFFEDAFGFGARGSKRQKSSIAPDYLQIIELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKALETCK 160
210135489  81 SDFSDFFEDLGSFFEDAFGFGTRGSKRQKSSIVPDYLQTLELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKALETCK 160
254779874  81 SDFSDFFEDLGSFFEDAFGFGARGGKRQKSSIAPDYLQTIELSFKEAVFGCKKTIKAQYQSVCESCDGTGAKDKALETCK 160
298735643  81 GDFSDFFEDLGSFFEDAFGFGARGSKRQKSSIAPDYLQTLELSFKEAVFGCKKTIKVQYQSVCESCDGTGAKDKALENCK 160
15612317  161 QCNGQGQVFMRQGFMSFAQTCGACQGKGKIIKTPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
15645945  161 QCNGQGQVFMRQGFMSFAQTCGACQGKGKIVKTPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
109946879 161 QCNGQGQVFMRQGFMSFAQTCGACKGKGKIIKTPCQACKGKTYILKDEEIDATIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
108563702 161 QCNGQGQVFMRQGFMSFAQTCGACQGKGKIIKTPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
208435228 161 QCNGQGQVFMRQGFMSFAQTCGACKGKGKIIKTPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
188528120 161 QCNGQGQVFMRQGFMSFAQTCGACKGKGKTIKTPCQACKGKTYILKDEEIDAMIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
210135489 161 QCNGQGQVFMRQGFMSFAQTCGACKGKGKIIKTPCQACKGKTYILKDEEIDAIIPESIDDQNRMVLKNKGNEYEKGKRGD 240
254779874 161 QCNGQGQVFMRQGFMSFAQTCGACQGKGKIIKNPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
298735643 161 QCSGQGQVFMRQGFMSFAQTCGACQGKGKIVKTPCQACKGKTYILKDEEIDAIIPEGIDDQNRMVLKNKGNEYEKGKRGD 240
15612317  241 LYLEARVKEDEHFKREGCDLFIKAPVFFTTIALGHTIKVPSLRGDELELKIPRNAKDRQAFAFRNEGVKHPESSYRGSLI 320
15645945  241 LYLEAQVKEDEHFKREGCDLFIKAPVFFTTIALGHTIKVPSLKGDELELKIPRNARDKQTFAFRNEGVKHPESSYRGSLI 320
109946879 241 LYLEVQVKEDEHFKRKGCDLFIEAPVFFTTIALGHTIKVPSLKGDELELKIPRNARDKQTFVFRNEGVKHPESSYRGSLI 320
108563702 241 LYLEARVKEDEHFKREGCDLFIEAPVFFTTIALGHTIKVPSLKGDELELKIPRNARDRQTFAFRNEGVKHPESSYRGSLI 320
208435228 241 LYLEVRVKEDEHFKREGCDLFIEAPVFFTTIALGHTIKVPSLKGGELELKIPRNAKDRQTFAFRNEGVKHPESSYRGSLI 320
188528120 241 LYLEARVKEDEHFKREGCDLFIEAPVFFTTIALGHTIKVPSLKGDELELKIPRNAKDRQTFAFRNEGVKHPESSYRGSLI 320
210135489 241 LYLEVRVKEDEHFKREGCDLFIKVPVFFTTIALGHTIKVPSLKGDELELKIPRNARDRQTFAFRNEGVKHPESSYRGSLI 320
254779874 241 LYLEARVKEDEHFKREGCDLFIEAPVFFTTIALGHTIKVPSLRGGELELKIPRNAKDRQTFAFRNEGVKHPESSYRGSLI 320
298735643 241 LYLEARVKEDEHFKREGCDLFIKAPVFFTTIALGHTIKVPSLKGDELELKIPRNARDRQTFAFRNEGVKHPESSYRGSLI 320
15612317  321 VELQVIYPKSLNKEQQGLLEKLHASFGYEGEPHKSVLETCVSKIKDWFK 369
15645945  321 VELQVIYPKSLNKEQQELLEKLHASFGYEGEPHKSVLETCISKIKDWFK 369
109946879 321 VVLQVVYPKSLDKEQQALLEKLHASFGYESEPHKGLLETCISKFKDWFK 369
108563702 321 VELQVIYPKSLNKEQQELLEKLHASFGYEGEPHKSVLETCISKIKDWFK 369
208435228 321 VVLQVIYPKSLNKEQQGLLEKLHASFGYEGEPHKSVLETCISKIKDWFK 369
188528120 321 VELQVIYPKSLNKEQQELLEKLHASFGYESEPHKSVLETCISKIKDWFK 369
210135489 321 VELQVIYPKSLNKEQQELLEKLHASFGYEGEPHKSVLETCISKIKDWFK 369
254779874 321 VVLQVIYPKSLNKEQQGLLEKLHASFGYEGEPHKGVLETCVSKIKDWFK 369
298735643 321 VELQVIYPKSLNKEQQELLEKLHASFGYEGEPHKSVLETCISKIKDWFK 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap