Conserved Protein Domain Family
PRK14286

?
PRK14286: PRK14286 
chaperone protein DnaJ; Provisional
Statistics
?
PSSM-Id: 172774
View PSSM: PRK14286
Aligned: 6 rows
Threshold Bit Score: 677.093
Threshold Setting Gi: 183222722
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
183222722   1 MSDRGYYEVLGVSKGASDDEIKSAYRKLAIKYHPDKNKGDKEAEEKFKEATEAYEVLRDPQKRQAYDQFGKAGVNAGAgG 80 
24216406    1 MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFGKAGVSGGA-G 79 
45656421    1 MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFGKAGVSGGA-G 79 
116330183   1 MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFGKAGVGAGA-G 79 
116329210   1 MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKGNKESEEKFKEATEAYEILRDPKKRQAYDQFGKAGVGAGA-G 79 
189912754   1 MSDRGYYEVLGVSKGASDDEIKSAYRKLAIKYHPDKNKGDKEAEEKFKEATEAYEVLRDPQKRQAYDQFGKAGVNAGAgG 80 
183222722  81 GYGAGAYTDFSDIFGDFGDIFSEFFGGGGGGGSrGGGRRSGPQRGSDLRYNLEVSLEDAALGKEYKIEIPRLETCVDCTG 160
24216406   80 GFGQGAYTDFSDIFGDFGDIFGDFFGGGRSSGF-GGGRRSGPQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCVDCNG 158
45656421   80 GFGQGAYTDFSDIFGDFGDIFGDFFGGGRSSGF-GGGRRSGPQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCVDCNG 158
116330183  80 GFGQGAYTDFSDIFGDFGDIFGDFFGGGRGGF--GGGRRSGSQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCGDCNG 157
116329210  80 GFGQGAYTDFSDIFGDFGDIFGDFFGGGRGGF--GGGRRSGSQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCGDCNG 157
189912754  81 GYGAGAYTDFSDIFGDFGDIFSEFFGGGGGGGSrGGGRRSGPQRGSDLRYNLEVSLEDAALGKEYKIEIPRLETCVDCTG 160
183222722 161 SGASKGSSPTVCPDCSGTGQVRRTQGFFSVTTTCPRCKGKGKVISNPCKTCKGEGLTEKRRTIHIKIPAGVESGSRLKVS 240
24216406  159 SGASKGSSPATCPDCGGSGQIRRTQGFFSVATTCPTCRGKGTIISNPCRSCGGQGLQEKRRTINIKIPPGVETGSRLKVS 238
45656421  159 SGASKGSSPATCPDCGGSGQIRRTQGFFSVATTCPTCRGKGTIISNPCRSCGGQGLQEKRRTINIKIPPGVETGSRLKVS 238
116330183 158 SGAAKGSSPTTCPDCGGSGQIRRTQGFFSVATTCPTCRGKGTTISNPCKTCGGQGLQEKRRTINIKIPPGVETGSRLKVS 237
116329210 158 SGAAKGSSPTTCPDCGGSGQIRRTQGFFSVATTCPTCRGKGTTISNPCKTCGGQGLQEKRRTINIKIPPGVETGSRLKVS 237
189912754 161 SGASKGSSPTVCPDCSGTGQVRRTQGFFSVTTTCPRCKGKGKVISNPCKTCKGEGLTEKRRTIHIKIPAGVESGSRLKVS 240
183222722 241 GEGESGPNGGPSGDLYVVTHIKKHPVFERQGNDLIVQKSISLSMACLGGEIEVPSIDGKTIQLKIPEGTESGQIFRLKGH 320
24216406  239 GEGEAGPNGGPHGDLYVVTHIKKHELFERQGNDLILVRKISLAQAILGAEIEVPTIDGKKAKMKIPEGTESGQVFRLKGH 318
45656421  239 GEGEAGPNGGPHGDLYVVTHIKKHELFERQGNDLILVRKISLAQAILGAEIEVPTIDGKKAKMKIPEGTESGQVFRLKGH 318
116330183 238 GEGEAGPNGGSHGDLYVVTHIKRHELFERQGNDLILVRKITLAQAILGAEIEVPTIDGKKAKMKIPEGTESGQVFRLKGH 317
116329210 238 GEGEAGPNGGSHGDLYVVTHIKRHELFERQGNDLILVRKITLAQAILGAEIEVPTIDGKKAKMKIPEGTESGQVFRLKGH 317
189912754 241 GEGESGPNGGPSGDLYVVTHIKKHPVFERQGNDLIVQKSISLSMACLGGEIEVPSIDGKTIQLKIPEGTESGQIFRLKGH 320
183222722 321 GIPYLGSYGKGDQHVIIKVEIPKKLSKKQKELMEEFARESGEKVgSGGKSKLFFR 375
24216406  319 GMPYLGAYGKGDQHVIVKIEIPKKITRRQRELIEEFARESGENI-PGSKGKIFTK 372
45656421  319 GMPYLGAYGKGDQHVIVKIEIPKKITRRQRELIEEFARESGENI-PGSKGKIFTK 372
116330183 318 GMPYLGAYGKGDQHVVVKIEIPKKITRRQRELIEAFARESGENI-PGSKGKIFTK 371
116329210 318 GMPYLGAYGKGDQHVVVKIEIPKKITRRQRELIEAFARESGENI-PGSKGKIFTK 371
189912754 321 GIPYLGSYGKGDQHVIIKVEIPKKLSKKQKELMEEFARESGEKVgSGGKSKLFFR 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap