Conserved Protein Domain Family
PRK14285

?
PRK14285: PRK14285 
chaperone protein DnaJ; Provisional
Statistics
?
PSSM-Id: 172773
View PSSM: PRK14285
Aligned: 8 rows
Threshold Bit Score: 639.731
Threshold Setting Gi: 111115345
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187918382   1 MKRDYYEILGLSKGASRDEIKKAYRKIAIKYHPDKNKDNKEAESIFKEATEAYEVLGDDNKRAQYDRFGHTAFEGGGtsG 80 
203284426   1 MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKNNKEAESIFKEATEAYEVLSDDNKRAQYDRFGHTAFEGGAs-G 79 
203287960   1 MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKDNKEAESIFKEATEAYEVLSDDNKRAQYDRFGHTAFEGGAs-G 79 
218249344   1 MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASIFKEATQAYEILIDDNKKAKYDRFGHSAFEGGG--- 77 
111115345   1 MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASIFKEATQAYEVLIDDNKKAKYDRFGHSAFEGGG--- 77 
119953305   1 MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKDNKEAESIFKEATEAYEVLGDDNKRAQYDRFGHTAFEGGG--G 78 
51598771    1 MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASIFKEATQAYEVLIDDNKKAKYDRFGHSAFEGGG--- 77 
15594862    1 MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGNEEAASIFKEATQAYEILIDDNKKAKYDRFGHSAFEGGG--- 77 
187918382  81 FNGFSSGFSGFSDIFEDFGDIFDSFFTGKRGQDKNRQHEKGQDITYQIEISLEDAYLGYNNNINIARNMLCESCLGKKSE 160
203284426  80 FSGFSSGFSGFSDIFEDFGDIFDSFFTGKRGQDKNRYQERGQDLTYQIEISLEDAYLGYKNNINISRNILCESCLGKKSE 159
203287960  80 FSGFSSGFSGFSDIFEDFGDIFDSFFTGKRGQDKNRYQERGQDLTYQIEISLEDAYLGYKNNINISRNILCESCLGKKSE 159
218249344  78 FEGFSGGFSGFSDIFEDFGDIFDSFFTGNKGQERNRKHAKGEDLGYNIEISLENAYFGYKNNINITRQMLCDSCLGKKSE 157
111115345  78 FEGFSGGFSGFSDIFEDFGDIFDSFFTGNKGQEKNRKHAKGEDVGYNIEISLENAYFGYKNDINITRQILCHSCFGKKSE 157
119953305  79 FSGFSNGFSGFSDIFEDFGDIFDSFFTGRRGQDKNRQNEKGQDITYQIEISLEDAYLGYKNNINIARNMLCESCLGKKSE 158
51598771   78 FEGFSGGFSGFSDIFEDFGDIFDSFFTGNKGQERNRKHARGEDLGYNIEISLENAYFGYKNNINITRQILCHSCLGKKSE 157
15594862   78 FEGFSGGFSGFSDIFEDFGDIFDSFFTGNKGQERNRKHAKGEDLGYNIEISLENAYFGYKNNINITRQMLCDSCLGKKSE 157
187918382 161 KGTSPSICNVCNGSGRVMQGGGFFRVTTTCPKCYGNGKIISNPCKSCKGTGSLKYKETIELKIPAGIDDSQQIKIRGKGS 240
203284426 160 KGTSPSVCNMCNGNGRVMQGGGFFRVTTTCPKCYGNGKIISNPCKSCKGAGGIKHKETLELKIPAGIDDSQQIKMRAKGS 239
203287960 160 KGTSPSVCNMCNGNGRVMQGGGFFRVTTTCPKCYGNGKIISNPCKSCKGAGGVKHKETLELKIPAGIDDAQQIKMRAKGS 239
218249344 158 KGTSPSICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLTKQETIQLNIPPGIDNNQQIKMKGKGN 237
111115345 158 KGTSPSICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLAKQETIQLNIPSGIDNNQQIKMKGKGN 237
119953305 159 KGTSPSICNMCNGSGRVMQGGGFFRVTTTCPKCHGNGKIISNPCKSCKGAGSLKYKETIELKIPAGIDDSQQIKMRGKGS 238
51598771  158 KGTSPSICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKTISNPCKSCKGKGRITNQETIQLNIPSGIDNNQQIKMKGKGN 237
15594862  158 KGTSPSICNMCNGSGRVVQGGGFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLTKQETIQLNIPPGIDNNQQIKMKGKGN 237
187918382 241 VNPDNQQYGDLYIRVSIKPHKIFKRNGKDLYATLPISFTQAALGKEIKIQTIAAKKIAIKIPKGTENDEQIIIKNEGMPI 320
203284426 240 INPDSQQYGDLYIKVLIKPHKIFKRNGKDLYATLPISFTQAALGKEIKIQTIANKKISIKIPKGTENDEQIIVKNEGMPI 319
203287960 240 INPDSQQYGDLYIKILIKPHKIFKRNGKDLYATLPISFTQAALGKEIKIQTIANKKISIKIPKGTENDEQIIVKNEGMPI 319
218249344 238 VNPDNQEYGDLYVKILIRSHKVFKRNGKDLYAMLPISFTQAALGKEVKIKTIASKEIKIHIPKGINNEEQILIKNAGMPI 317
111115345 238 VNPDNQEYGDLYVKILIRSHKIFKRNGKDLYAMLPISFTQAALGKEVRIKTIASKEIKIQIPKGIENEEQILIKNAGMPI 317
119953305 239 VNPDNQQYGDLYIRVSIKPHRIFKRNGKDLYATLPISFTQAALGKEIKIQTIAEKKIEIKIPKGTENDEQIIIKNEGMPI 318
51598771  238 VNPDNQEYGDLYVKILIRSHKIFKRNGKDLYAMLPISFTQAALGKEVRIKTIASKEIKIQIPKGIENEEQIIVKGAGMPI 317
15594862  238 VNPDNQEYGDLYVKILIRSHKVFKRNGKDLYAMLPISFTQAALGKEVKIKTIASKEIKIHIPKGINNEEQILIKNAGMPI 317
187918382 321 LHTEKFGNLILIIKIKTPKNLSHNATCLLEDLSKEIKDIDEITLNKV 367
203284426 320 LHTEKFGNLILIIKVKTPKNLNNNAIKLLETLSKEVKDIDEVTLNKI 366
203287960 320 LHTEKFGNLILIIKVKTPKNLNNNAIKLLETLSKEIKDIDEVTLNKI 366
218249344 318 LQTEKFGNLILITKIKTPKNLNSNAIKLFENLGKELKDGDEIDLLKA 364
111115345 318 LQTEKFGNLILITKIKTPKNLNSNAIKLFENLSKELRDGDEIDLLKV 364
119953305 319 LHTEKFGNLILIIKIKTPKNLSYNAIRLLEDLSKEINDIDKVTLNKI 365
51598771  318 LQTEKFGNLILITKIKTPKNLNSNAIKLFENLSKELRDGDEIDLLKV 364
15594862  318 LQTEKFGNLILITKIKTPKNLNSNAIKLFENLGKELKDGDEIDLLKA 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap