Conserved Protein Domain Family
PRK14274

?
PRK14274: PRK14274 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172762
View PSSM: PRK14274
Aligned: 6 rows
Threshold Bit Score: 528.326
Threshold Setting Gi: 154686755
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52081031    1 MSAVTAVKPEDVYQINDLNLWYGEHHALKNINLTIPEYEITAIIGPSGCGKSTFIKTLNLMINMVPNVKMTGEISYNGTN 80 
52786408    1 MSAVTAVKPEDVYQINDLNLWYGEHHALKNINLTIPEYEITAIIGPSGCGKSTFIKTLNLMINMVPNVKMTGEISYNGTN 80 
16079550    2 SIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIYENEVTAIIGPSGCGKSTFIKTLNLMIQMTPNVKLAGELNYNGSN 81 
154686755   2 SLVKEAVHTQNLFDIHGMNVWYGAHQALKDITIGFEERKVTAIIGPSGCGKSTFIKTLNLMLQMAPNVKVTGDMIYNGRN 81 
157692990   5 NAVATETAKKEVFRVNDMNLWYGQHHALKHIDLAIREHEVTAIIGPSGCGKSTFIKTLNLMVKTVPGVKITGDMMYKDDN 84 
305675149   2 SIATEAVMKQEVYQVNGMNLWYGQHHALKNINLSIHENEVTAIIGPSGCGKSTFIKTLNLMIQMTPNVKLAGELNYNGSN 81 
52081031   81 VLNSKVDLVELRKKVGMVFQKGNPFPQSIFDNVAYGPRIHGLKNKKELNERVEKALVDVALWDEVKDRLHSQALGLSGGQ 160
52786408   81 VLNSKVDLVELRKKVGMVFQKGNPFPQSIFDNVAYGPRIHGLKNKKELNERVEKALVDVALWDEVKDRLHSQALGLSGGQ 160
16079550   82 ILKDKVDIVDLRKNIGMVFQKGNPFPQSIFDNVAYGPRVHGTKNKKKLQEIVEKSLKDVALWDEVKDRLHTSALSLSGGQ 161
154686755  82 LLKEKTDAAELRKQIGMVFQKGNPFPQSIFENVVYGPRIHGEKNKKKLLEIAEESLKAAALWDEVKDRLHQQALSLSGGQ 161
157692990  85 ILKGRVDLVELRKNVGMVFQKGNPFPQSIFDNVVYGPRIHGVKSKQQLKEIAEKALRDVALWDEVKDRLSAPALGLSGGQ 164
305675149  82 ILKGKVDIVDLRKNIGMVFQKGNPFPQSIFDNVAYGPRVHGTKNKKKLQDIVEKSLKDVALWDEVKDRLHTSALSLSGGQ 161
52081031  161 QQRLCIARALATNPDVLLMDEPTSALDPVSTLKIEELMLKLKEKYTIAIVTHNMQQASRISDQTAFFLMGELIECNDTVK 240
52786408  161 QQRLCIARALATNPDVLLMDEPTSALDPVSTLKIEELMLKLKEKYTIAIVTHNMQQASRISDQTAFFLMGELIECNDTVK 240
16079550  162 QQRLCIARALATNPDILLMDEPTSALDPISTRKIEELILELKDKYTIVIVTHNMQQAARVSDQTAFFYMGELVECDNTNK 241
154686755 162 QQRLCIARALATKPDVLLMDEPTSALDPVSTRKIEELILTLKEKYTIVIVTHNMQQAARVSDQTAFFYMGELVEWGDTGK 241
157692990 165 QQRLCIARAIATSPDILLMDEPTSALDPVSTLKIEELIMKLKEKYTIAIVTHNMQQAARVSDRTAFFLMGELVEVNDTNV 244
305675149 162 QQRLCIARALATNPDILLMDEPTSALDPISTRKIEELILELKNKYTIVIVTHNMQQAARVSDQTAFFYMGELVECDNTNK 241
52081031  241 MFSSPDDHRTKDYITGRFG 259
52786408  241 MFSSPDDHRTKDYITGRFG 259
16079550  242 MFSNPKDQRTLDYISGKFG 260
154686755 242 IFSQPDHQKTHDYITGKFG 260
157692990 245 MFSEPNDQRTNDYISGRFG 263
305675149 242 MFSNPQDQRTLDYITGKFG 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap