Conserved Protein Domain Family
PRK14273

?
PRK14273: PRK14273 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172761
View PSSM: PRK14273
Aligned: 8 rows
Threshold Bit Score: 463.741
Threshold Setting Gi: 51598479
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
187918091   1 MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGCGKSTFLRTLNRMNDLVEGVKIEGKVIYEGKSIYSNN 80 
203287676   1 MNQDKAIIQTENLNLFYTDFKALSNINISILRNSITALIGPSGCGKSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNN 80 
203284138   1 MNQDKAIIQTENLNLFYTDFKALSNINISILRNSITALIGPSGCGKSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNN 80 
218249777   7 TPKNEVIIETENLNLFYTDFKALNKINIKILKNSITALIGPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGKNIYSNN 86 
111115042   7 KPKNEIIIETENLNLFYTDFKALNEINIKILKNSITALIGPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGKNIYSNN 86 
119953015   1 MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGCGKSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNN 80 
15594563    7 TPKNEVIIETENLNLFYTDFKALNKINMKILKNSITALIGPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGKNIYSNN 86 
51598479    7 KPKNEIIIETENLSLFYTDFKALNEINIKILKNSITALIGPSGCGKSTFLRTLNRMNDLVEGIKIEGNVIYEGKNIYSNN 86 
187918091  81 FDVLELRRKIGMVFQTPNPFLMSVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC 160
203287676  81 FDVLELRRKIGMVFQTPNPFLMSVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC 160
203284138  81 FDVLELRRKIGMVFQTPNPFLMSVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC 160
218249777  87 FDILELRRKIGMVFQTPNPFLMSIYDNISYGPKIHGTKDKRKLDEIVEQSLKKSALWNEVKDKLNTNALSLSGGQQQRLC 166
111115042  87 FDILELRRKIGMVFQTPNPFLMSIYDNISYGPKIHGTKDKKKLDEIVEQSLKKSALWDEVKDKLNTNALSLSGGQQQRLC 166
119953015  81 FDVLELRRKIGMVFQTPNPFLMSVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC 160
15594563   87 FDILELRRKIGMVFQTPNPFLMSIYDNISYGPKIHGTKDKKKLDEIVEQSLKKSALWNEVKDKLHTNALSLSGGQQQRLC 166
51598479   87 FDILELRRKIGMVFQTPNPFLMSIYDNISYGPKIHGTKDKKKLDEIVEQSLKKSALWDEVKDKLNTNALSLSGGQQQRLC 166
187918091 161 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGQIEEESQTDELFFNP 240
203287676 161 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGYIEEESKTDELFFNP 240
203284138 161 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGYIEEESKTDELFFNP 240
218249777 167 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGCIEEESSTDELFFNP 246
111115042 167 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGCIEEESPTDELFFNP 246
119953015 161 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGYIEEESQTDELFFNP 240
15594563  167 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDRTAFFLNGCIEEESSTDELFFNP 246
51598479  167 IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDKTAFFLNGCIEEESPTDELFFNP 246
187918091 241 KNTKTEEYITGKFG 254
203287676 241 KNIKTEEYITGKFG 254
203284138 241 KNIKTEEYITGKFG 254
218249777 247 KNTKTEEYISGKFG 260
111115042 247 KNTKTEEYISGKFG 260
119953015 241 KNIKTEEYITGKFG 254
15594563  247 KNTKTEEYISGKFG 260
51598479  247 KNTKTEEYISGKFG 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap