Conserved Protein Domain Family
PRK14272

?
PRK14272: PRK14272 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172760
View PSSM: PRK14272
Aligned: 3 rows
Threshold Bit Score: 542.681
Threshold Setting Gi: 226358224
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15807829    3 SPLLLSAQDVSIYYGDKQAVKNVNLDVRPGTVNAFIGPSGCGKTTFLRAINRMHDLTPGARVTGSILLDGQDIYSPSVDP 82 
94984759    1 MTPLLIASDVNIFYGEKQAVCGVNLNVQRGTVNALIGPSGCGKTTFLRAINRMHDLTPGARVTGRITLDGEDIYGPRVDP 80 
226358224   1 MTTLLSANDVNIYYGDKHAVKNVNLEFARGTVNALIGPSGCGKTTFLRAINRMHDLTPGARVTGRIILDGQDVYEPGVDP 80 
15807829   83 VAMRRRVGMVFQKPNPFPTMSVFDNVVAGLKLTGVKNRDHLMQVAERSLRGAALWDEVKDRLNTPATGLSGGQQQRLCIA 162
94984759   81 VTMRRRVGMVFQKPNPFPTMSVFDNVVSGLRLAGIRDRDHLMEVAERSLRGAALWDEVKDRLKTPATGLSGGQQQRLCIA 160
226358224  81 VAMRRRVGMVFQKPNPFPTMSVFDNVVAGLKLAGMRDRKQLMDVAERSLRGAALWDEVKDRLSSPATGLSGGQQQRLCIA 160
15807829  163 RALAVEPEILLMDEPTSALDPASTAKIEDLLGDLKKVTTIIIVTHNMHQAARVSDTTSFFLVGDLVEHGPTDQVFTNPRD 242
94984759  161 RALAVEPEILLMDEPTSALDPASTARIEDLMTDLKKVTTIIIVTHNMHQAARVSDTTSFFLNGELVEHGPTEQLFTSPRD 240
226358224 161 RALAVEPEILLMDEPTSALDPASTARIEDLMTDLKKVTTIVIVTHNMHQAARVSDTTSFFLVGDMVEHGATAQIFQAPRD 240
15807829  243 ERTEAYVSGRFG 254
94984759  241 ERTEAYVTGRFG 252
226358224 241 ERTEAYVSGRFG 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap