Conserved Protein Domain Family
PRK14269

?
PRK14269: PRK14269 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172757
View PSSM: PRK14269
Aligned: 6 rows
Threshold Bit Score: 457.182
Threshold Setting Gi: 218562267
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153951728   1 MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIEGKDVKNQDVVALRKN 80 
157414898   1 MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIEGKDVKNQDVVALRKN 80 
121613221   1 MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIEGKDVKNQDVVALRKN 80 
57238188    1 MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIEGKDVKNQDVVALRKN 80 
218562267   1 MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIKGKDVKNQDVVALRKN 80 
222823802   1 MIAKTTNLNLFYGKKQALFDINMEIQKNKITALIGASGCGKSTFLRCFNRMNDKIAKIDGLVEIDGKDVKNQDLVVLRKK 80 
153951728  81 VGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDDEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
157414898  81 VGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
121613221  81 VGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
57238188   81 VGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
218562267  81 VGMVFQQPNVFVKSIYENISYAPKLHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
222823802  81 VGMVFQQPNVFVKSIYDNISYAPKLHGMIKNKDEEDALVEDCLKKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIK 160
153951728 161 PKLLLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY 240
157414898 161 PKLLLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY 240
121613221 161 PKLLLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY 240
57238188  161 PKLLLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY 240
218562267 161 PKLLLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEFGESKEFFENPKQEKTKAY 240
222823802 161 PKLLLLDEPTSALDPISSSVIEELIKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELVEFGESKEFFENPKEEKTKAY 240
153951728 241 LSGAFG 246
157414898 241 LSGAFG 246
121613221 241 LSGAFG 246
57238188  241 LSGAFG 246
218562267 241 LSGAFG 246
222823802 241 LSGAFG 246
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap