Conserved Protein Domain Family
PRK14268

?
PRK14268: PRK14268 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172756
View PSSM: PRK14268
Aligned: 3 rows
Threshold Bit Score: 571.565
Threshold Setting Gi: 21228111
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21228111   1 MTEVVQNVAQTHITVENLNLWYGEKQALKNVSLKIPRNSVTALIGPSGCGKSTFIRCLNRMNDLVKNCRIEGKVLIENED 80 
20089774   1 MTEAVQNVAQPQIEVENLNLWYGEKQALKNISMQIPKNSVTALIGPSGCGKSTFIRCLNRMNDLIKNCRIEGKVSIEDED 80 
73669287   1 MTEGIQNVSQPQIKIENLNLWYGEKQALKNVSMQIPKNSITALIGPSGCGKSTFIRCLNRMNDLINNCRIEGKVSIEGKD 80 
21228111  81 IYGTDVDVVELRKQVGMVFQKPNPFPMSIYDNVAYGPRIHGVNKKDIDGVVRNALRSAALFEETSDRLKSPALSLSGGQQ 160
20089774  81 IYEKGVDVVELRKRVGMVFQKPNPFPMSIYDNIAYGPRIHGANKKDLGGIVEFALRSAALWNETSDRLKSTALSLSGGQQ 160
73669287  81 IYEPDVDAVELRKNVGMVFQKPNPFPMSIYDNVAYGPRIHGANKKDLDGVVEQALRSAAIWDEVSDRLKSPALSLSGGQQ 160
21228111 161 QRLCIARTLAVKPRIILFDEPTSALDPISTARIEDLIMNLKKDYTIVIVTHNMQQAARISDYTGFFLMGELVEFGQTRQI 240
20089774 161 QRLCIARTLAVKPEIILFDEPCSALDPISTSRIEELIMNLKKDYTIVIVTHNMQQAARVSDYTGFFLMGELIEFGKTRQI 240
73669287 161 QRLCIARTLAVKPKTILFDEPTSALDPISTLRIEDLTMELKKDYTIVIVTHNMQQAARISDYTGFFLMGELIEFDQTRQI 240
21228111 241 FHSPREKSTEDYITGRFG 258
20089774 241 FHNPKEQSTEDYITGRFG 258
73669287 241 FQNPREKSTEDYITGRFG 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap