Conserved Protein Domain Family
PRK14263

?
PRK14263: PRK14263 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172751
View PSSM: PRK14263
Aligned: 5 rows
Threshold Bit Score: 546.919
Threshold Setting Gi: 167034141
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
167034141   1 MVSEAtPIVMDCKLDKIFYGNFMAVRDSHVPIRKNEITGFIGPSGCGKSTVLRSLNRMNDLVKGFRFEGHVHFLGQDVYG 80 
26989378   19 MVSEA-PIVMDCKLDKIFYGNFMAVRDSHVPIRKNEITGFIGPSGCGKSTVLRSLNRMNDLVKGFRFEGHVHFLGQDVYG 97 
148547388   1 MVSEA-PIVMDCKLDKIFYGNFMAVRDSHVPIRKNEITGFIGPSGCGKSTVLRSLNRMNDLVKGFRFEGHVHFLGQDVYG 79 
229590767  12 FITQS-PVVMDCKLDKIFYGNFMAVRDSHVPIEKNKITGFIGPSGCGKSTVLRSLNRMNDLVKGFRFEGHVHFLGQDVYG 90 
217978788  11 KPVDGpDVAISCSVQKIFYGAFLAVRDSNVPIEKGKITGFIGPSGCGKSTVLRSLNRMNDLIKGFRLEGQVNFLGQDIYG 90 
167034141  81 KGVDPVVVRRYIGMVFQQPNPFSMSIFDNVAFGLRLNRYKGDLGDRVKHALQGAALWDEVKDKLKVSGLSLSGGQQQRLC 160
26989378   98 KGVDPVVVRRYIGMVFQQPNPFSMSIFDNVAFGLRLNRYKGDLGDRVKHALQGAALWDEVKDKLKVSGLSLSGGQQQRLC 177
148547388  80 KGVDPVVVRRYIGMVFQQPNPFSMSIFDNVAFGLRLNRYKGDLGDRVKHALQGAALWDEVKDKLKVSGLSLSGGQQQRLC 159
229590767  91 KGVDPVVVRRYIGMVFQQPNPFSMSIFDNVAFGLRLNRYKGDLGDRVKHALQGAALWDEVKDKLKVSGLSLSGGQQQRLC 170
217978788  91 AGVDPVVVRRHIGMVFQQPNPFSMSIFDNVAFGLRLNRFKGDAAEKVEHALRRAALWDEVKDKLKASGLSLSGGQQQRLC 170
167034141 161 IARAIATEPEVLLLDEPCSALDPIATRRVEELMVELKKDYTIALVTHNMQQAIRVADTTAFFSVDISQGTRTGYLVEMGP 240
26989378  178 IARAIATEPEVLLLDEPCSALDPIATRRVEELMVELKKDYTIALVTHNMQQAIRVADTTAFFSVDISQGTRTGYLVEMGP 257
148547388 160 IARAIATEPEVLLLDEPCSALDPIATRRVEELMVELKKDYTIALVTHNMQQAIRVADTTAFFSVDISQGTRTGYLVEMGP 239
229590767 171 IARAIATEPEVLLLDEPCSALDPIATRRVEELMVELKKDYTIALVTHNMQQAIRVADTTAFFSVDISQGTRTGYLVEMGA 250
217978788 171 IARAVATEPTVLLMDEPCSALDPIATRRIEELMLELKKDYTIALVTHNMQQARRVADVTAFFSVDISQGGRTGHLVEIGD 250
167034141 241 TAQIFQNPREQLTSDYISGKFS 262
26989378  258 TAQIFQNPREQLTSDYISGKFS 279
148547388 240 TAQIFQNPREQLTSDYISGKFS 261
229590767 251 TTQIFENPREQMTGDYISGKFS 272
217978788 251 TNELFDSPREEMTKKYLRGEFS 272
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap