Conserved Protein Domain Family
PRK14262

?
PRK14262: PRK14262 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172750
View PSSM: PRK14262
Aligned: 7 rows
Threshold Bit Score: 494.827
Threshold Setting Gi: 148270634
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
217076254   1 MEIIEFKNFGAYYGEKKVVNNVTFPVYINKITAIIGPSGCGKSTLLRSINRINDEIPGFKVEGSLLIDGKDVYKDVDDLT 80 
170289340   2 EPIIEIENFSAYYGDKVAVKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHIPGFRVEGKIYFKGQDIYDPKLDVT 81 
222100286   2 EPIIEIENFSAYYGDKVAVKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHIPGFRVEGKIYFKGQDIYDPKLDVT 81 
148270634   2 EPIIEIENFSAYYGEKIAVKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHLPGFRVEGKIYFKGQDIYDPQLDVT 81 
150021692   1 MKIIEIKNFSAFYGEKKVVKNVSFDIFKNKITAIIGPSGCGKSTLLRSVNRINDNIPGFKIEGNIYFEGKDIYDGDVDVT 80 
15644017    2 EPIIEIENFSAYYGEKIAVKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHLPGFRVEGKIYFKGQDIYDPQLDVT 81 
281412944   2 EPIIEIENFSAYYGEKIAVKNVTMKIFKNQITAIIGPSGCGKTTLLRSINRMNDHLPGFRVEGKIYFKGQDIYDPQLDVT 81 
217076254  81 VLRKKVGMVFQRPVPFPMSIYENIAFGLKIHGVKDKSKINKIVEKTLKEAALWDEVKHELDKNAYSLSGGQQQRLCIARS 160
170289340  82 EYRKKVGMVFQKPTPFPMSIYDNVAFGPRIHGTKSKHVLDRIVEESLKKAALWDEVKSELNKPGTKLSGGQQQRLCIARA 161
222100286  82 EYRKKVGMVFQKPTPFPMSIYDNVAFGPRIHGTKSKHVLDRIVEESLKKAALWDEVKSELNKPGTKLSGGQQQRLCIARA 161
148270634  82 EYRKRVGMVFQKPTPFPMSIYDNVAFGPRIHGVKSKHILDRIVEESLKKAALWDEVKSELNKSGTRLSGGQQQRLCIARA 161
150021692  81 ILRKKIGMVFQKPVPFPMSIYDNVSFGLKIHGIKRKEKLDEIVEKSLKQAALWDEVRQELNEPASELSGGQQQRLCIART 160
15644017   82 EYRKRVGMVFQKPTPFPMSIYDNVAFGPRIHGVKSKHILDRIVEESLKKAALWDEVKSELNKSGTRLSGGQQQRLCIARA 161
281412944  82 EYRKRVGMVFQKPTPFPMSIYDNVAFGPRIHGVKSKHILDRIVEESLKKAALWDEVKSELNKSGTRLSGGQQQRLCIARA 161
217076254 161 LAIEPEVLLLDEPTSALDPIATQRIESLLERLSEKYTIVIVTHNIAQAIRISDYIAFMFKGELIEFGETSEVVRNPKNKL 240
170289340 162 LAVEPEVILLDEPTSALDPIATQRIEKLLEELSENYTIVIVTHNIGQAIRIADYIAFMYRGELVEYGPTREIVERPKSKL 241
222100286 162 LAVEPEVILLDEPTSALDPIATQRIEKLLEELSENYTIVIVTHNIGQAIRIADYIAFMYRGELVEYGPTREIVERPKSKL 241
148270634 162 LAVEPEVILLDEPTSALDPIATQRIEKLLEELSENYTIVIVTHNIGQAIRIADYIAFMYRGELIEYGPTREIVERPKNRL 241
150021692 161 LAIQPEVLLLDEPTSALDPIATQKIEALLEKLSEFYTIAIVTHNLSQAIRISDYVAFMYQGELIEFADTPTIVKKPQHKL 240
15644017  162 LAVEPEVILLDEPTSALDPIATQRIEKLLEELSENYTIVIVTHNIGQAIRIADYIAFMYRGELIEYGPTREIVERPKNRL 241
281412944 162 LAVEPEVILLDEPTSALDPIATQRIEKLLEELSENYTIVIVTHNIGQAIRIADYIAFMYRGELIEYGPTREIVERPKNRL 241
217076254 241 TEEYLNGKIG 250
170289340 242 TEEYLTGKIG 251
222100286 242 TEEYLTGKIG 251
148270634 242 TEEYLTGKIG 251
150021692 241 TEAYLNGKIG 250
15644017  242 TEEYLTGKIG 251
281412944 242 TEEYLTGKIG 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap