Conserved Protein Domain Family
PRK14261

?
PRK14261: PRK14261 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172749
View PSSM: PRK14261
Aligned: 5 rows
Threshold Bit Score: 528.245
Threshold Setting Gi: 124485936
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
88604211    1 MNEEIIIDVQGLNLWYGENHALHNVTLPIPNRKVTALIGPSGCGKSTLIRCFNRMNDLVSGCRVTGDILYHGQNINGTGA 80 
126180218   1 MTGSTILETTNLNLWYGQKHALIDISIRIPKNRVTALIGPSGCGKSTLLRCFNRMNDLIDSSSVTGEIRFNGNDIHDPRA 80 
124485936   1 --MTSILSTKNLNLSYGSKQTLYDIDFSFEEKSVTALIGPSGCGKSTLLRCMNRMNDLIPDCKITGDISYRGENIMTS-- 76 
154151459   1 MSDSTVIATKNLNLWYNEKHALQDITMDIEKKKTTALIGPSGCGKSTLLRCFNRMNDLISHVKITGQLLLDEEDMLCNGM 80 
219851147   2 ATSEIVLRTEDLDLWYGEKKALKGVTIGITRNRVTALIGPSGCGKSTLLRCFNRMNDLVPGCRIEGGLFFNDTPLSDI-P 80 
88604211   81 DPVDLRRKIGMVFQKPNPFPKSIYENIAYGPRIHGIKNKRDLDEIVESCLHKAALWEEVKDRLHDSAMSLSGGQQQRLCI 160
126180218  81 DVYAIREKIGMVFQKPNPFPKSIYENVAYGPRIHGMREKGTLDRIVEESLKGAALWDEVKDRLHEPALSLSGGQQQRLCI 160
124485936  77 DPVLLRRKIGMVFQRPNPFPKSIYDNIAYGPRAHGEKDKKTLDAVVEKSLKGAVLWDEVKDRLHESALGLSGGQQQRLCI 156
154151459  81 DVVALRKRVGMVFQRPNPFPKSIYENVAYGPRVHGINDRKELDTIVEKSLRHAALWDEVRDRLNDSALGLSGGQQQRLCI 160
219851147  81 DVVQLRKHIGMVFQRPNPFPKSIYENVAYGPRIHGERNSAALDTIVEQSLKQSALWEEVKDRLHDSALSLSGGQQQRLCI 160
88604211  161 ARTLAVNPEIILMDEPCSALDPIATSKIEDLIEELKKEYCVIIVTHSMSQASRVSDYTAFMYLGDLIEFGETRQIFENPH 240
126180218 161 ARCLAVEPEAILMDEPCSALDPIATAKIEDLIIQIAREHTVVIVTHNMQQAARASDYTGFMYLGRLVEFDKTTKIFEDPG 240
124485936 157 ARTLAVNPDVILMDEPCSALDPIATAKIENLIMDLKKDYTVIIVTHNMQQAARVSDITGFMYLGKMIEADKTTTIFSNPH 236
154151459 161 ARTLAVEPEVILMDEPCSALDPIATAKIENLIEMLKEYYTVIIVTHNMQQAARVSDYTGFMYLGKLIEFDKTTTIFEHPN 240
219851147 161 ARTLAVGPDVILMDEPCSALDPIATSKIEELITKLSEQYTVIIVTHSMQQASRVSDYTGFMYIGELVEFGETTQIFERPE 240
88604211  241 KELTENYITGRFG 253
126180218 241 EELTENYITGRFG 253
124485936 237 EELTERYITGRFG 249
154151459 241 EDLTENYITGRFG 253
219851147 241 KELTENYITGRFG 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap