Conserved Protein Domain Family
PRK14260

?
PRK14260: PRK14260 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172748
View PSSM: PRK14260
Aligned: 3 rows
Threshold Bit Score: 544.232
Threshold Setting Gi: 186684233
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
186684233   1 MSNLIPAIKVKNISFYYGATKAIEKVSIDIYQKQVTAIIGPSGCGKSTFIKILNRISELEGPVKVEGDVEFFGQNIYDSR 80 
17228403    2 NQQLVPAIKVKDLSFYYNTSKAIEGISMDIYRNKVTAIIGPSGCGKSTFIKTLNRISELEGPVKVEGVVDFFGQNIYDPR 81 
75910710    2 NQQLIPAIKVKDLSFYYNTSKAIEGISMDIYRNKVTAIIGPSGCGKSTFIKTLNRISELEGPVKVEGVVDFFGQNIYDPR 81 
186684233  81 VNINRLRRQIGMVFQKPNPFPISIYENVAYGMRIAGRNSKLELDEIVESALKSAALWDEVKDKLDKSALGLSGGQQQRLC 160
17228403   82 ININRLRRQIGMVFQRPNPFPMSIYENVAYGVRISAKLPQADLDEIVESALKGAALWQEVKDKLNKSALGLSGGQQQRLC 161
75910710   82 ININRLRRQIGMVFQRPNPFPMSIYENVAYGVRISAKLPQADLDEIVESALKGAALWQEVKDKLNKSALGLSGGQQQRLC 161
186684233 161 IARALAVKPKVLLMDEPCSALDPIATMKVEELLHSLQSELTIAIVTHNMQQAARVSDFTAFFSTDESRIGQMIEFGATEQ 240
17228403  162 IARALAIKPKVLLMDEPCSALDPIATMKVEELIHSLRSELTIAIVTHNMQQATRVSDFTAFFSTDESRIGQMVEFGVTTQ 241
75910710  162 IARALAIKPKVLLMDEPCSALDPIATMKVEELIHSLRSELTIAIVTHNMQQATRVSDFTAFFSTDESRIGQMVEFGVTTQ 241
186684233 241 IFNNPLDPRTRDYISGRFG 259
17228403  242 IFSNPLDSRTRDYVSGRFG 260
75910710  242 IFSNPLDSRTRDYVSGRFG 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap