Conserved Protein Domain Family
PRK14259

?
PRK14259: PRK14259 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172747
View PSSM: PRK14259
Aligned: 18 rows
Threshold Bit Score: 551.326
Threshold Setting Gi: 72382149
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
78779113    1 MIKTNKKTPKNIILSLENVSISYGTFEAVRNVFCNFKKGNITSLIGPSGCGKSTVLRSLNRMNDLIPNCSLKGTVLFDGT 80 
78212929    6 QPQATESHNTDVALSLQNVTISYGNFEAVKNVYCEIPRGKVTAFIGPSGCGKSTVLRSLNRMNDLIEGCSLKGSILFGGV 85 
72382149    1 --MNKKNIKTTSSVSLDNVSIRYGNSVAVKNVFCDIEKNQVTSFIGPSGCGKSTVIRAINRMNDLIEGCKLSGSVIFEGI 78 
113953952   5 SSSESPDPNVDVCVSIQNATISYGDFEAVKNVYCDIPRGQVTAFIGPSGCGKSTILRALNRMNDLIEGCSLKGRILFDGA 84 
157413147   1 MIKTNKKTPKNIILSLENVSISYGTFEAVRNVFCNFKKGNITSLIGPSGCGKSTVLRSLNRMNDLIPNCSLKGTVLFDGT 80 
123966097   1 MIKNNKKTAKNIILSLDNVSISYGTFEAVKNVFCNFKKGNITSLIGPSGCGKSTVLRSLNRMNDLIPNCSLNGTVLFDGT 80 
123968312   1 MIKTNKKIPKNIILSLENVSISYGTFEAVRNVFCNFKKGNITSLIGPSGCGKSTVLRSLNRMNDLIPNCSLKGTVLFDGT 80 
124025689   1 --MNKKNIKTTTSVSLDNVSIRYGNSVAVKNVFCDIEKNQVTSFIGPSGCGKSTVIRAINRMNDLIEGCKLSGSVIFEGI 78 
126696115   1 MIKTNKKIPKNIILSLENVSISYGTFEAVRNVFCNFKKGNITSLIGPSGCGKSTVLRSLNRMNDLIPNCSLKGTVLFDGT 80 
33861282    1 MIKNTKKSQKNKILTLEDVSISYGTFEAVRNVFCNFKSGDITSLIGPSGCGKSTVLRALNRMNDLIPNCSLRGTVLFDGT 80 
78779113   81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFTGDMDELVESSLRKAALWDECKDKLNDSGYSLSGGQQ 160
78212929   86 DLYGPKIDPVEVRRRIGIVFQQPNPFPKSIYENIAFGARINGYTGDMDELVERSLRQAAVWDECKDKLNESGYSLSGGQQ 165
72382149   79 DIYAEDIDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARVNGYKGNMDQLVEESLTKAAVWDECKDKLNESGYSLSGGQQ 158
113953952  85 DLYAPEVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGYNGDMDELVERSLRQAAIWDECKDKLNESGNSLSGGQQ 164
157413147  81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFTGEMDELVESSLRKAALWDECKDKLNDSGYSLSGGQQ 160
123966097  81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFAGDMNELVERSLRKAALWDECKDKLNDSGYSLSGGQQ 160
123968312  81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFTGDMDELVESSLRKAALWDECKDKLNDSGYSLSGGQQ 160
124025689  79 DIYAEDIDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARVNGYKGNMDQLVEESLTKAAVWDECKDKLNESGYSLSGGQQ 158
126696115  81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFTGDMDELVESSLKKAALWDECKDKLNDSGYSLSGGQQ 160
33861282   81 NIYDKRVDPVEVRRRIGMVFQQPNPFPKSIYENIAFGARINGFVGDMDELVESSLRKAAVWSECKDKLNDSGYSLSGGQQ 160
78779113  161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKMNYTIIIVTHNMQQALRVSDMTAFFNAVEYEDGDgGKVG 240
78212929  166 QRLCIARTIAIQPEVILMDEPCSALDPISTLKIEETMHELKKSFTIVIVTHNMQQAVRVSDMTAFYNAEAVEGGT-GKVG 244
72382149  159 QRLCIARTIAIEPDVILMDEPCSALDPLSTLKIEETIHELKKNFTIIIVTHNMQQANRVSDYTAFFNTEKKDKDLgGKIG 238
113953952 165 QRLCIARTIAIEPEVILMDEPCSALDPISTLKIEETIHELKKSFTIVIVTHNMQQAVRVSDMTAFFNAEAVDGES-GKVG 243
157413147 161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKKNYTIIIVTHNMQQALRVSDMTAFFNAIEYEDGDgGKVG 240
123966097 161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKKNYTIIIVTHNMQQALRVSDMTAFFNAIEHEDGDgGKVG 240
123968312 161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKKNCTIIIVTHNMQQALRVSDMTAFFNAIEYEDGDgGKVG 240
124025689 159 QRLCIARTIAIEPDVILMDEPCSALDPLSTLKIEETIHELKKNFTIIIVTHNMQQANRVSDYTAFFNTEKKDKDLgGKIG 238
126696115 161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKKNYTIIIVTHNMQQALRVSDMTAFFNAIEYEDGDgGKVG 240
33861282  161 QRLCIARTIAIEPEIILMDEPCSALDPISTLKIEETMHELKKNYTIIIVTHNMQQALRVSDMTAFFNAVEYEEGDgGKVG 240
78779113  241 YLAEFNSTKKIFNSPKEKTTQEYISGKFG 269
78212929  245 YLVEFNDTDKIFNAPQQQATQDYVSGRFG 273
72382149  239 FLVEFDKTKNMFNSPKQKSTQDYISGKFG 267
113953952 244 YLVEFNDTDKIFNAPSQQATQDYVSGRFG 272
157413147 241 YLAEFNSTKKIFNSPKEKTTQEYISGKFG 269
123966097 241 YLAEFNSTKRIFSSPKEKTTQEYISGKFG 269
123968312 241 YLAEFNSTKKIFNSPKEKTTQEYISGKFG 269
124025689 239 FLVEFDKTKNMFNSPKQKSTQDYISGKFG 267
126696115 241 YLAEFNSTKKIFSSPKEKTTQEYISGKFG 269
33861282  241 YLAEFDSTKKIFSSPKEKTTQEYISGKFG 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap