Conserved Protein Domain Family
PRK14257

?
PRK14257: PRK14257 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172745
View PSSM: PRK14257
Aligned: 3 rows
Threshold Bit Score: 642.163
Threshold Setting Gi: 13357758
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13357758    1 MNDQKDNKEIQTIVPLNQKTNLNELDAKAIYDEFQKLNKYQRAFAWLKLPKQKKAELKQFLNKKKTQVDLLKEDFNHANV 80 
170762201   1 MNDQKDNKEIQTIVPLNQKTNLNELDAKAIYDEFQKLNKYQRAFAWLKLPKQKKAELKQFLNKKKTQVDLLKEDFNHANV 80 
209554133   1 MNDQKDNKEIQTIVPLNQKTNLNELDAKAIYDEFQKLNKYQRAFAWLKLPKQKKAELKQFLNKKKTQVDLLKEDFNDANV 80 
13357758   81 FEIRNFNFWYMNRTKHVLHDLNLDIKRNKVTAFIGPSGCGKSTFLRNLNQLNDLIEGTSHEGEIYFLGTNTRSKKISSLE 160
170762201  81 FEIRNFNFWYMNRTKHVLHDLNLDIKRNKVTAFIGPSGCGKSTFLRNLNQLNDLIEGTSHEGEIYFLGTNTRSKKISSLE 160
209554133  81 FEIRNFNFWYMNRTKHVLHDLNLDIKRNKVTAFIGPSGCGKSTFLRNLNQLNDLIEGTSHEGEIYFLGTNTRSKKISSLE 160
13357758  161 LRTRIGMVFQKPTPFEMSIFDNVAYGPRNNGINDRKILEKIVEKSLKSAALWDEVKDDLDKAGNALSGGQQQRLCIARAI 240
170762201 161 LRTRIGMVFQKPTPFEMSIFDNVAYGPRNNGINDRKILEKIVEKSLKSAALWDEVKDDLDKAGNALSGGQQQRLCIARAI 240
209554133 161 LRTRIGMVFQKPTPFEMSIFDNIAYGPRNNGINDRKILEKIVEKSLKSAALWDEVKDDLDKAGNALSGGQQQRLCIARAI 240
13357758  241 ALEPEVLLMDEPTSALDPIATAKIEELILELKKKYSIIIVTHSMAQAQRISDETVFFYQGWIEEAGETKTIFIHPKNKRT 320
170762201 241 ALEPEVLLMDEPTSALDPIATAKIEELILELKKKYSIIIVTHSMAQAQRISDETVFFYQGWIEEAGETKTIFIHPKNKRT 320
209554133 241 ALEPEVLLMDEPTSALDPIATAKIEELILELKKKYSIIIVTHSMAQAQRISDETVFFYQGWIEEAGETKTIFIHPKNKRT 320
13357758  321 KDYISGKIG 329
170762201 321 KDYISGKIG 329
209554133 321 KDYISGKIG 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap