Conserved Protein Domain Family
PRK14256

?
PRK14256: PRK14256 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172744
View PSSM: PRK14256
Aligned: 7 rows
Threshold Bit Score: 515.716
Threshold Setting Gi: 222055104
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
197118103   1 MNNKVQLEQVNIHFGKNHAVKDISMTFPENSVTAIIGPSGCGKSTLLRSMNRMHDLVPSARVTGKILVDDGDIYDRGVDP 80 
197118232   1 MNNKVQLEQVNIHFGKNHAVKDISMTFPENSVTAIIGPSGCGKSTLLRSMNRMHDLVPSARVTGKILVDDGDIYDRGVDP 80 
222055104   1 MQNKVKLEQLNVHFGANHAVKSVSMEFPENSVTAIIGPSGCGKSTVLRAINRMHDLVPSAQVTGKILLDDTDIYDKGADP 80 
78223900    1 MNTKVKIDKLNVHFGQTHAVKDVSIDVPENTVTAIIGPSGCGKSTMLRSLNRMHDLFPNARVTGKVLLDGNDIYDRKVDP 80 
148264606   1 MNTKVKLENLNVHFGSNHAVKDVSIDFPENSVTAIIGPSGCGKSTVLRSINRMHDLAPAARVTGKIILDDTDIYDKGVDP 80 
148263581   1 MNTKVKLENLNVHFGSNHAVKDVSIDFPENSVTAIIGPSGCGKSTVLRSINRMHDLAPAARVTGKIILDDTDIYDKGVDP 80 
253701115   1 MNNKVQLEQVNIHFGKNHAVKDISMTFPENSVTAIIGPSGCGKSTLLRSMNRMHDLVPSARVTGKILVDDGDIYDRGVDP 80 
197118103  81 VAIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRLPREEADEIVESCLKRVALWDEVKDRLKSNAMMLSGGQQQRLCIA 160
197118232  81 VAIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRLPREEADEIVESCLKRVALWDEVKDRLKSNAMMLSGGQQQRLCIA 160
222055104  81 VTIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRINRAEADGIVESSLKRVALWDEVKDRLRGNAMELSGGQQQRLCIA 160
78223900   81 VSIRRRVGMVFQKPNPFPAMSIYDNVVAGYKLNGRVKKSDADEIVETSLRRVALWDEVKDRLKSNSMELSGGQQQRLCIA 160
148264606  81 VSIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRVNRSEADEIVESSLKRVALWDEVKDRLKASAMELSGGQQQRLCIA 160
148263581  81 VSIRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRVNRSEADEIVESSLKRVALWDEVKDRLKASAMELSGGQQQRLCIA 160
253701115  81 VAVRRRVGMVFQKPNPFPAMSIYDNVIAGYKLNGRLPREEADEIVESCLKRVALWDEVKDRLKSNAMMLSGGQQQRLCIA 160
197118103 161 RTVAVKPEVILMDEPASALDPISTLKIEELIEELKERYTIIIVTHNMQQAARVSDYTAFLYMGDLVECGETKKIFTTPEV 240
197118232 161 RTVAVKPEVILMDEPASALDPISTLKIEELIEELKERYTIIIVTHNMQQAARVSDYTAFLYMGDLVECGETKKIFTTPEV 240
222055104 161 RTIAVKPEVILMDEPASALDPISTLKIEELIEELKEKYTIIIVTHNMQQAARVSDYTAFFYLGELVEDGETRKIFTTPDK 240
78223900  161 RTIAVQPEVILMDEPASALDPISTLKIEELIEELTEKYTIIIVTHNMQQAARVSDYTAFFYMGDLVEWGETKKLFTTPEK 240
148264606 161 RTIAVRPEVILMDEPASALDPLSTLKIEELIEELKEKYTIIIVTHNMQQAARVSDFTAFFYLGELIECGETRKVFTTPDK 240
148263581 161 RTIAVRPEVILMDEPASALDPLSTLKIEELIEELKEKYTIIIVTHNMQQAARVSDFTAFFYLGELIECGETRKVFTTPDK 240
253701115 161 RTVAVKPEVILMDEPASALDPISTLKIEELIEELKERYTIIIVTHNMQQAARVSDYTAFLYMGDLVECGETKKIFTTPEQ 240
197118103 241 KRTEDYITGRFG 252
197118232 241 KRTEDYITGRFG 252
222055104 241 KQTEDYITGRFG 252
78223900  241 KQTEDYITGRFG 252
148264606 241 KQTEDYITGRFG 252
148263581 241 KQTEDYITGRFG 252
253701115 241 KRTEDYITGRFG 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap