Conserved Protein Domain Family
PRK14255

?
PRK14255: PRK14255 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172743
View PSSM: PRK14255
Aligned: 7 rows
Threshold Bit Score: 521.072
Threshold Setting Gi: 258539151
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
29376304    1 MGKEIISSKDLHLYYGKKEALKGIDLTFNQGELTAMIGPSGCGKSTYLRCLNRMNDLIPDVTITGSVVYKGKDIYGPKTD 80 
81428119    1 MANKIIESSDVHLFYGKNEALKGINMDFAENEITALIGPSGCGKSTYLRCLNRMNDLIDSATVTGKFLLNGQDIYAPEMD 80 
116494447   3 EAKKIITSSNVHLFYGKFEALKGIDLDFNQNEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGNVSLRGNNIYSPNED 82 
191637832   3 EAKKIITSSNVHLFYGKFEALKGIDLDFNQNEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGNVSLRGNNIYSPNED 82 
258539151   3 EAQKIITSSDVHLFYGKFEALKGINLDFNEHEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGTISLRGQNIYAPSED 82 
258507905   3 EAQKIITSSDVHLFYGKFEALKGINLDFNEHEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGTISLRGQNIYAPSED 82 
301065957   3 EAKKIITSSNVHLFYGKYEALKGIDLDFNQNEITALIGPSGCGKSTYLRTLNRMNDLIPGVTITGNVSLRGNNIYSPNED 82 
29376304   81 NVELRKEIGMVFQQPNPFPFSVYENVIYGLRLKGVKDKQVLDEAVETSLKAAAVWEDVKDKLHKSALSLSGGQQQRVCIA 160
81428119   81 TVKLRKEVGMVFQQPNPFPFSIYDNVVYGLRLSGVKDHRVLDEAVETSLKQAAVWDDVKDKLHESALSLSGGQQQRVCIA 160
116494447  83 VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGVKDKAVLDEAVETSLKQAAIWDEVKDHLHESALSLSGGQQQRVCIA 162
191637832  83 VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGIKDKAVLDEAVETSLKQAAIWDEVKDHLHESALSLSGGQQQRVCIA 162
258539151  83 VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGVKDKSILDEAVETSLKQAAIWDEVKDHLHDSALSLSGGQQQRVCIA 162
258507905  83 VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGVKDKSILDEAVETSLKQAAIWDEVKDHLHDSALSLSGGQQQRVCIA 162
301065957  83 VVQLRKQVGMVFQQPNPFPFSIYENVIYGLRLAGVKDKAVLDEAVETSLKQAAIWDEVKDHLHESALSLSGGQQQRVCIA 162
29376304  161 RVLAVEPDIILLDEPTSALDPVSSGKIENMLLTLKEKYTMIMVTHNMSQASRISDKTAFFLQGDLIEFNDTKKVFLNPKE 240
81428119  161 RVLAVKPKVILMDEPTSALDPISSTKIENMLLELRQQYTIIMVTHNMHQASRISDKTAFFLQGELIEYAPTKKIFLNPTE 240
116494447 163 RVLAVKPDVILLDEPTSALDPISSTQIENMLLELRDQYTIILVTHSMHQASRISDKTAFFLTGNLIEFADTKQMFLNPKE 242
191637832 163 RVLAVKPDVILLDEPTSALDPISSTQIENMLLELRDQYTIILVTHSMHQASRISDKTAFFLTGNLIEFADTKQMFLNPKE 242
258539151 163 RVLAVKPDVVLLDEPTSALDPISSTQIENMLLELRDQYTIILVTHSMHQASRISDKTAFFLTGNLIEFADTKQMFLNPKE 242
258507905 163 RVLAVKPDVVLLDEPTSALDPISSTQIENMLLELRDQYTIILVTHSMHQASRISDKTAFFLTGNLIEFADTKQMFLNPKE 242
301065957 163 RVLAVKPDVILLDEPTSALDPISSTQIENMLLELRDQYTIILVTHSMHQASRISDKTAFFLTGNLIEFADTKQMFLNPKE 242
29376304  241 KQTEDYISGKFG 252
81428119  241 KETEDYISGRFG 252
116494447 243 KETEDYITGRFG 254
191637832 243 KETEDYITGRFG 254
258539151 243 KETEDYITGRFG 254
258507905 243 KETEDYITGRFG 254
301065957 243 KETEDYITGRFG 254
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap