Conserved Protein Domain Family
PRK14253

?
PRK14253: PRK14253 
phosphate ABC transporter ATP-binding protein; Provisional
Statistics
?
PSSM-Id: 172741
View PSSM: PRK14253
Aligned: 19 rows
Threshold Bit Score: 491.279
Threshold Setting Gi: 212637820
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
28901313    1 MNKFDIENLDLFYGENQALKSINLPIPVRQVTALIGPSGCGKSTLLRCLNRMNDLIEGVKITGKLAMDGEDIYGNIDVAD 80 
59712220    1 MNKFNIENLDLFYGQNQALKNINLPIPAKQVTALIGPSGCGKSTLLRCLNRMNDLIEGVKITGLVNLDGNDIYGNIDVAD 80 
54308584    6 MNKFNIDNLNLFYGENQALKQICLPIPNRQVTALIGPSGCGKSTLLRCLNRMNDLIEGVKIDGLLSMDGEDVYGNIDVAQ 85 
24375771    1 MSKFEVTHLNLFYGENHALKDISIDIPARQVTALIGPSGCGKSSLLRTLNRMNDLVEGVKITGTVTFDGDDIYANIDVKH 80 
119946230   1 MNKLEINNLNLFYGKNHALKDISFIIPERKVTALIGPSGCGKSTLLRTLNRMNDLIAGVTITGEVKFKNEDIYADIDVQD 80 
167626184   1 MNKLEVNNLNLFYGDNHALKDITLAIPARQVTALIGPSGCGKSTLLRTLNRMNDLVAGVKIDGDVMFEGSNIYRDVDVKQ 80 
157964042   1 MNKLEVNNLNLFYGDNHALKNISLAIPARQVTALIGPSGCGKSTLLRTLNRMNDLVAGVKINGDVMFDGSNIYQDVDVKH 80 
197335001   1 MNKFNIENLDLFYGQNQALKNINLPIPAKQVTALIGPSGCGKSTLLRCLNRMNDLIEGVKITGLVNLDGNDIYGNIDVAD 80 
218675990   1 MNKFNIKDLDLFYGENQALKSINLPVPERQVTALIGPSGCGKSTLLRCLNRMNDLIEGVKITGLLEMDGDNIYGNIDVAD 80 
209695564   1 MNKFNIENLDLFYGQNQALKGINLPIPAKQVTALIGPSGCGKSTLLRCLNRMNDLIPGVKITGFVSLDDHDIYGNIDVAD 80 
28901313   81 LRIKVGMVFQKPNPFPMSIYENVAYGLRAQGIKDKKTIDEVVERSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTI 160
59712220   81 LRIKVGMVFQKANPFPMSIYENVAYGLKAQGVKDKKVLDAVVEKSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTI 160
54308584   86 LRIKVGMVFQKPNPFPMSIYENVAYGLRAQGIKDKKVLDGVVEQSLRGAALWDEVKDRLKSHAFSLSGGQQQRLCIARTI 165
24375771   81 LRMSVGMVFQKPNPFPMSIYENIAFGLKAQGVKDKAVLDAVVENSLRGAALWEEVKTRLHTPAFGLSGGQQQRLCIARAI 160
119946230  81 LRMRVGMVFQKANPFPMSIYENVAFGLKAQGMKDKKELSKIVEESLRSAALWDEVSDRLNMLATGLSGGQQQRLCIARAI 160
167626184  81 LRMRVGMVFQKPNPFPMSIYENVAFGLKAQGIKDKQVLDSAVEESLRSAALWDEVKDRLNTPAFGLSGGQQQRLCIARTI 160
157964042  81 LRMRVGMVFQKPNPFPMSIYENVAFGLRAQGVKDKQVLDDTVEESLRSAALWDEVKDRLNTPAFGLSGGQQQRLCIARTI 160
197335001  81 LRIKVGMVFQKANPFPMSIYENVAYGLKAQGVKDKKVLDAVVEKSLRGAALWDEVKDRLKSHAFGLSGGQQQRLCIARTI 160
218675990  81 LRIKVGMVFQKPNPFPMSIYENVAYGLRAQGIKDKKHIDEVVESSLRGAALWDEVKDRLKAHAFGLSGGQQQRLCIARTI 160
209695564  81 LRIKVGMVFQKANPFPMNIYENVAYGLKAQGVKDKKVLDAVVEKSLRSAALWDEVKDRLKSHAFGLSGGQQQRLCIARTI 160
28901313  161 AMEPDVILMDEPTSALDPIATHKIEELMEELKKNYTIVIVTHSMQQARRISDRTAFFLMGELVEHNDTQVIFSNPQDDRT 240
59712220  161 AMEPDVILMDEPTSALDPIATHKVEELMETLKKDYTIVIVTHSMQQARRISDKTAFFLMGELVEHDDTQIIFSNPKDDRT 240
54308584  166 AMEPEVILMDEPTSALDPIATKKIEDLMESLKKDFTIVIVTHSMQQARRISDRTAFFLMGELVEHDDTHALFSNPRDDRT 245
24375771  161 AMEPEVILMDEPTSALDPIATHKIEELMDELRKKFTIVIVTHSMNQAKRISDKTAFFWMGELVEHGDTEQIFNNPKDHRT 240
119946230 161 AMKPEVILMDEPTSALDPIATHKIEELMDELRKKFTIVIVTHSMNQAKRISDKTAFFWMGELVEYGDTAELFNNPIDKRT 240
167626184 161 AMKPEVILMDEPTSALDPIATHKIEGLMDELRKQFTIVIVTHSMNQAKRISDKTAFFWMGELVEHGETTQIFNHPLDQRT 240
157964042 161 AMKPEVILMDEPTSALDPIATHKIEGLMDELRKQFTIVIVTHSMNQAKRISDKTAFFWMGELVEHGETSQIFNQPRDQRT 240
197335001 161 AMEPDVILMDEPTSALDPIATHKVEELMETLKKDYTIVIVTHSMQQARRISDKTAFFLMGELVEHDDTQIIFSNPKDDRT 240
218675990 161 AMQPDVILMDEPTSALDPIATHKIEELMEDLKKNFTIVIVTHSMQQARRISDRTAFFLMGELVEHNETSVIFSEPKDDRT 240
209695564 161 AMEPDVILMDEPTSALDPIATHKIEELMETLKQDYTIVIVTHSMQQARRISDKTAFFLMGELVEHDDTHVIFSNPKDDRT 240
28901313  241 QGYVNGDFG 249
59712220  241 QGYVNGDFG 249
54308584  246 RGYVNGDFG 254
24375771  241 QGYVSGHFG 249
119946230 241 QGYVSGEFG 249
167626184 241 QGYVSGEFG 249
157964042 241 QGYVSGEFG 249
197335001 241 QGYVNGDFG 249
218675990 241 KGYVNGDFG 249
209695564 241 QGYVNGDFG 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap